TkA02G550830 | RubberDandelionOmics

Gene overview

TkA02G550830

Reference: TK1151 Chr: Chr02 Coordinates: 142114604-142122386 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1330 bp · TkA02G550830|TK1151|cDNA

CCCGGCCTATCCATTTTAGAATAATAAATTCACCGATCTTCTTTCACACAAATGCCACCCGCCGACCCGCGCATTCAAATCCATGTCATATATCTCTCTCTTTCTCTCTCTCTGATTTCTGTATATATGTACATGAGAGAATAGATTGATTTCTTCAGAGTTCAGCTAAATTCTCAGTCTCATATACACACACACACTTAGAACAGGCATATATAAAAGTTGAACTGAAAATGGGAGTATTGTCGTTGATATCAGGATGG...

CDS

Download CDS FASTA

966 bp · TkA02G550830|TK1151|CDS

ATGGGAGTATTGTCGTTGATATCAGGATGGCCAGGGAAGAGTGGGTTCGGATCGGCCTCCACTGCTGAGCAAGTTTCAGCTTCCATTGATGCCTCCGATCTTAATGTTATCATTACAGGGGGAGCAAGTGGGATTGGGTTGGAGACGTCAAGAGTATTAGCAATGAGGGGAGCTCATGTGACTATAGCTGCAAGGAACATGAAGGCAGCAAATGAAGCTAAACAACTTATTCTTAAAGACAATCAGAATGCCAAGATTGA...

Protein

Download Protein FASTA

321 aa · TkA02G550830|TK1151|PROTEIN

MGVLSLISGWPGKSGFGSASTAEQVSASIDASDLNVIITGGASGIGLETSRVLAMRGAHVTIAARNMKAANEAKQLILKDNQNAKIDVLELDLSSLKSIKTFSDTFKALNLPLNVLINNAGVMFCPYQLSKDGIEMQFATNHLGHFYLTNLLLDKMKETAASTGIEGRIVNLSSIAHQYTYQQGIRFDKINDKDSYSDKRAYGQSKLANILHASELSRRLKEEGANITVNSVHPGIIMTDLMRHSYWQMRILKLFSYFIW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G550830`
TK1151 ID	TkA02G550830
OH-1004 ID	LXL04_026436
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	57.800
Protein coverage (%)	TK1151 98.131 / OH-1004 99.683 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G550830

Location Chr02:142114604-142122386 (-)

Description Similar to TIC32: Short-chain dehydrogenase TIC 32, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g23430`	Involved in protein precursor import into chloroplasts.	Tic32, an essential component in chloroplast biogenesis.2004 · DOI: 10.1074/jbc.m402817200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026436 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015031 protein transport Biological Process

GO:0016055 Wnt signaling pathway Biological Process

GO:0030178 negative regulation of Wnt signaling pathway Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0071560 cellular response to transforming growth factor beta stimulus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT4G23430

bna:106397857

hsa:51741

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.261

Rank 1 · TkA02G550830 · TK1151

Endoplasmic reticulum0.239

Rank 2 · TkA02G550830 · TK1151

Mitochondrion0.235

Rank 3 · TkA02G550830 · TK1151

Peroxisome0.186

Rank 4 · TkA02G550830 · TK1151

Nucleus0.087

Rank 5 · TkA02G550830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01494FAD_binding_335-79 aa

PF00106adh_short36-183 aa

PF08659KR36-123 aa

PF01370Epimerase36-212 aa

PF00070Pyr_redox41-89 aa

PF13561adh_short_C242-244 aa

PF08659KR145-174 aa

PF01494FAD_binding_3154-214 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G550830	`PF01494`	FAD_binding_3	35	79	0.25	11.2
TkA02G550830	`PF00106`	adh_short	36	183	6.5e-32	111.3
TkA02G550830	`PF08659`	KR	36	123	5.5e-09	36.9
TkA02G550830	`PF01370`	Epimerase	36	212	0.00019	21.7
TkA02G550830	`PF00070`	Pyr_redox	41	89	0.085	14.1
TkA02G550830	`PF13561`	adh_short_C2	42	244	1.2e-17	65.0
TkA02G550830	`PF08659`	KR	145	174	5.5e-09	36.9
TkA02G550830	`PF01494`	FAD_binding_3	154	214	0.25	11.2
TkA02G550830	`PF00106`	adh_short	196	244	6.5e-32	111.3
TkA02G550830	`PF00070`	Pyr_redox	214	231	0.085	14.1
TkA02G550830	`PF00106`	adh_short	290	300	6.5e-32	111.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2RVM0`	Arabidopsis thaliana	sp\|A2RVM0\|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic	55.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card