TkA02G546890 | RubberDandelionOmics

Gene overview

TkA02G546890

Reference: TK1151 Chr: Chr02 Coordinates: 141108573-141113407 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2685 bp · TkA02G546890|TK1151|cDNA

ACACAAAGAACACCCCACTCTTCACATCTCAGTTAAGAGCAGAGAGCAGAGACTAGAGAGGAGAAGAGACGAGTGACTTGGGAACTGCATCACTGCCTTTAAAGATAAAACACCCACCATCTTAGCTAGGGTTTCATCTTCTTTTTCTTCTTCAAGCTTCCGCTATTTCACCCCAATCGGGTCACTACACTTGCAGATTACCAACTTCCCCCCTCCGTACAACTCTAATCTCTCAGGTCACTGTGGGTCAACTTTCTTTA...

CDS

Download CDS FASTA

1827 bp · TkA02G546890|TK1151|CDS

ATGCAAACACCAAAGCCCAGAGTCGGAACCTTGGAGGTGCCACAGAGGACACCTAAGACGGCTAGGCAGCTCAAAACTTCAGGGACAGAACCGGAAAATTCTTCCGTTCAAAGTCCGGTAACAAGAACGCCTAAACCTAGGAGTCCCAAAGTTTCTGGCCGGTCACCTCGTACTCCAACGTCCGAGAAAAAACGTCCTGGGAGAGTGGCGGAACTGGAAACCCAGCTTGCTAATCTTCAGGAAGAACTTAAGAAAGCCAA...

Protein

Download Protein FASTA

608 aa · TkA02G546890|TK1151|PROTEIN

MQTPKPRVGTLEVPQRTPKTARQLKTSGTEPENSSVQSPVTRTPKPRSPKVSGRSPRTPTSEKKRPGRVAELETQLANLQEELKKAKDQLSESEANKKRASEDADVAKKQLADMSEKLQDSQQQLDEISASEESRLQELRKISQDRDRAWESELEAVQKHHSMDSAALASAMNEIQKLKNQLEELSESEANQAKYAESAHNDVLALRLELSETLAVVEELKNELNDSKYSEAKALEIISQTKEQLETVKSTEETLRSEKA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G546890`
TK1151 ID	TkA02G546890
OH-1004 ID	LXL04_014814
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	37.700
Protein coverage (%)	TK1151 96.875 / OH-1004 81.188 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G546890

Location Chr02:141108573-141113407 (+)

Description Similar to ICR3: Interactor of constitutive active ROPs 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37080`	Acts as a scaffold, mediating interaction of ROPs with different proteins.	No verified direct reference in this release
`At5g60210`	Acts as a scaffold, mediating interaction of ROPs with different proteins.	No verified direct reference in this release
`At3g53350`	ROP effector binding specifically activated ROPs and linking them to the microtubule cytoskeleton.	Rho of plant GTPase signaling regulates the behavior of Arabidopsis kinesin-13A to establish secondary cell wall patterns.2013 · DOI: 10.1105/tpc.113.117853
`At1g78430`	Acts as a scaffold, mediating interaction of ROPs with different proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014814 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009664 plant-type cell wall organization Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0090404 pollen tube tip Cellular Component

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT1G17140

ath:AT1G78430

ath:AT2G37080

ath:AT3G53350

ath:AT5G60210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.538

Rank 1 · TkA02G546890 · TK1151

Cell membrane0.263

Rank 2 · TkA02G546890 · TK1151

Nucleus0.221

Rank 3 · TkA02G546890 · TK1151

Plastid0.078

Rank 4 · TkA02G546890 · TK1151

Golgi apparatus0.066

Rank 5 · TkA02G546890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08614ATG1628-141 aa

PF07888CALCOCO167-223 aa

PF13851GAS67-161 aa

PF24161CCDC3969-315 aa

PF30358GOLM69-141 aa

PF30778SBP_bac_4HB71-144 aa

PF27682ICR5_C75-126 aa

PF10432bact-PGI_C101-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G546890	`PF08614`	ATG16	28	141	0.052	14.4
TkA02G546890	`PF07888`	CALCOCO1	67	223	0.0051	16.5
TkA02G546890	`PF13851`	GAS	67	161	0.029	14.5
TkA02G546890	`PF24161`	CCDC39	69	315	0.24	9.9
TkA02G546890	`PF30358`	GOLM	69	141	1.6	9.1
TkA02G546890	`PF30778`	SBP_bac_4HB	71	144	0.0043	18.0
TkA02G546890	`PF27682`	ICR5_C	75	126	1.7e-21	77.7
TkA02G546890	`PF10432`	bact-PGI_C	101	139	4.5	7.9
TkA02G546890	`PF08614`	ATG16	135	223	0.052	14.4
TkA02G546890	`PF07888`	CALCOCO1	144	329	0.0051	16.5
TkA02G546890	`PF27682`	ICR5_C	165	210	1.7e-21	77.7
TkA02G546890	`PF30778`	SBP_bac_4HB	166	189	0.0043	18.0
TkA02G546890	`PF30358`	GOLM	168	242	1.6	9.1
TkA02G546890	`PF13851`	GAS	171	228	0.029	14.5
TkA02G546890	`PF30778`	SBP_bac_4HB	173	190	0.0043	18.0
TkA02G546890	`PF10432`	bact-PGI_C	177	270	4.5	7.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQC5`	Arabidopsis thaliana	sp\|Q9ZQC5\|ICR2_ARATH Interactor of constitutive active ROPs 2, chloroplastic	39.800%	Swiss-Prot	Medium
`Q9LSS5`	Arabidopsis thaliana	sp\|Q9LSS5\|ICR3_ARATH Interactor of constitutive active ROPs 3	38.200%	Swiss-Prot	Medium
`Q8VYU8`	Arabidopsis thaliana	sp\|Q8VYU8\|ICR5_ARATH Interactor of constitutive active ROPs 5	32.400%	Swiss-Prot	Medium
`Q9M9F9`	Arabidopsis thaliana	sp\|Q9M9F9\|ICR4_ARATH Interactor of constitutive active ROPs 4	32.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card