TkA02G545960 | RubberDandelionOmics

Gene overview

TkA02G545960

Reference: TK1151 Chr: Chr02 Coordinates: 140828081-140829730 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1369 bp · TkA02G545960|TK1151|cDNA

GAAAAATAAGTGTTTTTCCTACTATTTTGTTCCAGATTTTTCTGTTTTGCCTTGTATATAAATGCCACTCTACTCATCATCCATATATCGAAAACACTCTCTCAGAGCCTCACAAACACAGAGAAACACACAAATCTTTGAGAAATGGGCAAAGATGTTGAGGTTGGTGGTGGTCATGAATACACCGCAAAAGATTACCAAGACCCTCCGCCGGCTGCCTTTTTTGACGCCGAGGAACTCACCAAATGGTCTTTCTACAG...

CDS

Download CDS FASTA

858 bp · TkA02G545960|TK1151|CDS

ATGGGCAAAGATGTTGAGGTTGGTGGTGGTCATGAATACACCGCAAAAGATTACCAAGACCCTCCGCCGGCTGCCTTTTTTGACGCCGAGGAACTCACCAAATGGTCTTTCTACAGAGCCATCATCGCTGAGTTCGTTGCCACCCTTTTGTTCCTTTACATCACCGTCTTGACTGTCATCGGCTACAAGGCCCAGACCGATCCCCTGCACAGCGACGACCAGTGCGGCGGCGTAGGAATTTTAGGTATCGCGTGGGCTTT...

Protein

Download Protein FASTA

285 aa · TkA02G545960|TK1151|PROTEIN

MGKDVEVGGGHEYTAKDYQDPPPAAFFDAEELTKWSFYRAIIAEFVATLLFLYITVLTVIGYKAQTDPLHSDDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVTFPRAVLYIVAQCLGAICGCGLVKAFQKTYYNTYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVMYGKDKAWDDQWIFWVGPMIGAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G545960`
TK1151 ID	TkA02G545960
OH-1004 ID	LXL04_012678
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G545960

Location Chr02:140828081-140829730 (-)

Description Similar to PIP2-4: Probable aquaporin PIP2-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60660`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release
`At2g37170`	Water channel required to facilitate the transport of water across cell membrane.	No verified direct reference in this release
`At3g53420`	Water channel required to facilitate the transport of water across cell membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012678 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006833 water transport Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0048767 root hair elongation Biological Process

GO:0080170 hydrogen peroxide transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0015250 water channel activity Molecular Function

GO:0031625 ubiquitin protein ligase binding Molecular Function

KEGG gene cross-reference

ath:AT2G37170

ath:AT3G53420

ath:AT5G60660

dosa:Os02g0629200

zma:541890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.788

Rank 1 · TkA02G545960 · TK1151

Cytoplasm0.113

Rank 2 · TkA02G545960 · TK1151

Endoplasmic reticulum0.091

Rank 3 · TkA02G545960 · TK1151

Lysosome / Vacuole0.067

Rank 4 · TkA02G545960 · TK1151

Golgi apparatus0.042

Rank 5 · TkA02G545960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00230MIP31-266 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G545960	`PF00230`	MIP	31	266	1.7e-85	287.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FF53`	Arabidopsis thaliana	sp\|Q9FF53\|PIP24_ARATH Probable aquaporin PIP2-4	83.600%	Swiss-Prot	High
`P43287`	Arabidopsis thaliana	sp\|P43287\|PIP22_ARATH Aquaporin PIP2-2	82.100%	Swiss-Prot	High
`P43286`	Arabidopsis thaliana	sp\|P43286\|PIP21_ARATH Aquaporin PIP2-1	81.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card