TkA02G545780 | RubberDandelionOmics

Gene overview

TkA02G545780

Reference: TK1151 Chr: Chr02 Coordinates: 140765525-140767270 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1133 bp · TkA02G545780|TK1151|cDNA

AAGCAAGAAGCAAATAAGCTTTGATGAACGATTAAAAAATAAATCAAATGAAAATATTCAAGCATAAAGTTGTAGACTTTAGGAAAACATTCGCCTCTAGGCATTGATGTCCACCGATTACCAACTTCCCTCAATCTCTTGGAAGAAATCTATGCATTCTCCTCTTTGAAAAAACCCCAAAGTCCAAAAGTTCGTCGGGCAATCTACAAATCGCATATCATCTCTGTGAAGAATCGTCTTCTTCAGTAGTGTTTATGCAA...

CDS

Download CDS FASTA

540 bp · TkA02G545780|TK1151|CDS

ATGAGTCGGCCGGCGGTACATCCGGTGGAGCCGCCGCCTTTGATTGACGGAAGAAACGATGCAGCGCCGCCTCGAAGAGTAAGGATGAAAGACGTGCAAGGCATGCCTGGTACGTCAACTGGACTCGCCCTCCGTCTCTGTCAGTTCGCATTCACCGTTATTTCTCTCGCCGTCATGGCTTCGACATCTGATTTCCCCTCCGTCACCGCTTTCCGATACCTTGTTGCTGCTGTTGGGTTGCAAAGTTTATGGAGCTTGAC...

Protein

Download Protein FASTA

179 aa · TkA02G545780|TK1151|PROTEIN

MSRPAVHPVEPPPLIDGRNDAAPPRRVRMKDVQGMPGTSTGLALRLCQFAFTVISLAVMASTSDFPSVTAFRYLVAAVGLQSLWSLTLAMIDIYALCVRRSLRNPAVITAYTIGDGVTSTITFAAACACAGITVLISNDLNRCDINHCKRFMSATAMAFISWFAVSPSFFLNFWSLASS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G545780`
TK1151 ID	TkA02G545780
OH-1004 ID	LXL04_012685
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G545780

Location Chr02:140765525-140767270 (+)

Description Similar to gba_locus_10451: CASP-like protein 5A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28370`	CASP-like protein 5A2.	No verified direct reference in this release
`At2g37200`	CASP-like protein 5A1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0206600`	CASP-like protein 5A1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012685 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G28370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.861

Rank 1 · TkA02G545780 · TK1151

Cytoplasm0.085

Rank 2 · TkA02G545780 · TK1151

Endoplasmic reticulum0.061

Rank 3 · TkA02G545780 · TK1151

Nucleus0.041

Rank 4 · TkA02G545780 · TK1151

Lysosome / Vacuole0.040

Rank 5 · TkA02G545780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04535CASP_dom35-164 aa

PF01284MARVEL42-169 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G545780	`PF04535`	CASP_dom	35	164	6.6e-27	94.8
TkA02G545780	`PF01284`	MARVEL	42	169	1.8e-05	25.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKN3`	Arabidopsis thaliana	sp\|Q9SKN3\|CSPL6_ARATH CASP-like protein 5A2	65.200%	Swiss-Prot	High
`Q6NPF8`	Arabidopsis thaliana	sp\|Q6NPF8\|CSPL9_ARATH CASP-like protein 5A1	67.200%	Swiss-Prot	High
`Q10Q78`	Oryza sativa subsp. japonica	sp\|Q10Q78\|CSPLV_ORYSJ CASP-like protein 5A1	65.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card