TkA02G545060 | RubberDandelionOmics

Gene overview

TkA02G545060

Reference: TK1151 Chr: Chr02 Coordinates: 140563346-140565633 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1784 bp · TkA02G545060|TK1151|cDNA

GAAAAAACAAAACTTGTGGGGCCAAATATACAAATAACCACACTTATAATAATAAAAGATATACAAAAGGAGGAACTTACAAAGCCCTTTTAGTAAAGTATCGTAAAAAGGAGGGGCCAAAATATACAATTCCCGTTCTTCTTTTTATCGGCAGTCGCTGCAACTCCAACCCACCGGAATCCTGGAGCTAAACCATTCAGCATAGTCGAGTATCCAACCTGATTAAGAGATGGAAGCCGAAAGCAAAAGTTTGGATAGAA...

CDS

Download CDS FASTA

927 bp · TkA02G545060|TK1151|CDS

ATGGAAGCCGAAAGCAAAAGTTTGGATAGAATGAGCGCACTTCCCGAAGATACAGTTGAAAAAATCCTGAGTCATATGCCGATCAAAGATGCAGTGAGGACGAGCATCTTGTCAAGGAAATGGAGGTATTCATGGACGAACATGCCAAGACTTGTATTTGATGATGAGCTGGTGAATGTATTAATTTCTGACGAAGAGGAAGAAATCGATAAATATAAGTTTGTGAGGGTCATCTTTCACATTTTGTTGCTACATAAAGG...

Protein

Download Protein FASTA

308 aa · TkA02G545060|TK1151|PROTEIN

MEAESKSLDRMSALPEDTVEKILSHMPIKDAVRTSILSRKWRYSWTNMPRLVFDDELVNVLISDEEEEIDKYKFVRVIFHILLLHKGPISELCIHITDRELMSGIVNEIDQIILHLSWSKNIKKFVYDVANTIIRKYYKLPHSFFSFQGLQHLSLKACEIELPLVFNGFSMLKSLAFYRVEITANTLQRFLTNCPLLEEFTWVSSLQNILMQIRARRIELTECEFVELFNCLPSVQVLEISKLHIIHFNVGDIPHKLPVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G545060`
TK1151 ID	TkA02G545060
OH-1004 ID	LXL04_011160
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	74.000
Protein coverage (%)	TK1151 98.701 / OH-1004 54.597 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G545060

Location Chr02:140563346-140565633 (+)

Description Similar to At1g13570: F-box/FBD/LRR-repeat protein At1g13570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13570`	F-box/FBD/LRR-repeat protein At1g13570.	No verified direct reference in this release
`At5g52460`	Putative F-box/FBD/LRR-repeat protein At5g52460.	No verified direct reference in this release
`At4g00160`	F-box/FBD/LRR-repeat protein At4g00160.	No verified direct reference in this release
`At5g56370`	FBD-associated F-box protein At5g56370.	No verified direct reference in this release
`At5g02910`	F-box/LRR-repeat protein At5g02910.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011160 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G13570

ath:AT2G04230

ath:AT3G26922

ath:AT5G56370

ath:AT5G56440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.688

Rank 1 · TkA02G545060 · TK1151

Cytoplasm0.438

Rank 2 · TkA02G545060 · TK1151

Endoplasmic reticulum0.043

Rank 3 · TkA02G545060 · TK1151

Cell membrane0.038

Rank 4 · TkA02G545060 · TK1151

Mitochondrion0.019

Rank 5 · TkA02G545060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box12-50 aa

PF12937F-box-like12-42 aa

PF07723LRR_216-24 aa

PF07723LRR_253-63 aa

PF07723LRR_2113-119 aa

PF24758LRR_At5g56370117-217 aa

PF23622LRR_At1g61320_AtMIF1120-294 aa

PF07723LRR_2150-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G545060	`PF00646`	F-box	12	50	6.3e-10	39.3
TkA02G545060	`PF12937`	F-box-like	12	42	0.0039	17.6
TkA02G545060	`PF07723`	LRR_2	16	24	0.018	16.4
TkA02G545060	`PF07723`	LRR_2	53	63	0.018	16.4
TkA02G545060	`PF07723`	LRR_2	113	119	0.018	16.4
TkA02G545060	`PF24758`	LRR_At5g56370	117	217	2.2e-14	54.4
TkA02G545060	`PF23622`	LRR_At1g61320_AtMIF1	120	294	1.1e-06	29.1
TkA02G545060	`PF07723`	LRR_2	150	159	0.018	16.4
TkA02G545060	`PF12799`	LRR_4	150	161	1.0	10.5
TkA02G545060	`PF07723`	LRR_2	171	195	0.018	16.4
TkA02G545060	`PF12799`	LRR_4	191	199	1.0	10.5
TkA02G545060	`PF12799`	LRR_4	227	241	1.0	10.5
TkA02G545060	`PF24758`	LRR_At5g56370	233	296	2.2e-14	54.4
TkA02G545060	`PF12799`	LRR_4	242	269	1.0	10.5
TkA02G545060	`PF12799`	LRR_4	262	294	1.0	10.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ70`	Arabidopsis thaliana	sp\|Q9FZ70\|FDL1_ARATH F-box/FBD/LRR-repeat protein At1g13570	29.400%	Swiss-Prot	Low
`Q9FHB5`	Arabidopsis thaliana	sp\|Q9FHB5\|FDL42_ARATH Putative F-box/FBD/LRR-repeat protein At5g52460	30.600%	Swiss-Prot	Medium
`Q8LF09`	Arabidopsis thaliana	sp\|Q8LF09\|FDL23_ARATH F-box/FBD/LRR-repeat protein At4g00160	29.100%	Swiss-Prot	Low
`Q9FM94`	Arabidopsis thaliana	sp\|Q9FM94\|FBD21_ARATH FBD-associated F-box protein At5g56370	29.300%	Swiss-Prot	Low
`Q9LYZ4`	Arabidopsis thaliana	sp\|Q9LYZ4\|FBL79_ARATH F-box/LRR-repeat protein At5g02910	26.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card