TkA02G543940 | RubberDandelionOmics

Gene overview

TkA02G543940

Reference: TK1151 Chr: Chr02 Coordinates: 140284013-140284354 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

342 bp · TkA02G543940|TK1151|cDNA

ATGACACATTGTGGATGGAACTCGGTTTTGGAAAGTATATGGTGTGGGGTGCCTTTGATTTGCTTTTCTCTTCTGACTGATCAATTCACAAATAGAAAATTAGTAGTTGATGATTGGAAAGTTGGGATTAATCTATGTGAAGGGCATTTGGTCGAAAATGAGGAGGTCACAAAGAAAGTCAAAGATTTAATGATCATAGGAGCGAAGTCAAACGAGTTGAGGGAGGAGATGAAGAAAATCAAAACAACACTACAAGATGC...

CDS

Download CDS FASTA

342 bp · TkA02G543940|TK1151|CDS

ATGACACATTGTGGATGGAACTCGGTTTTGGAAAGTATATGGTGTGGGGTGCCTTTGATTTGCTTTTCTCTTCTGACTGATCAATTCACAAATAGAAAATTAGTAGTTGATGATTGGAAAGTTGGGATTAATCTATGTGAAGGGCATTTGGTCGAAAATGAGGAGGTCACAAAGAAAGTCAAAGATTTAATGATCATAGGAGCGAAGTCAAACGAGTTGAGGGAGGAGATGAAGAAAATCAAAACAACACTACAAGATGC...

Protein

Download Protein FASTA

113 aa · TkA02G543940|TK1151|PROTEIN

MTHCGWNSVLESIWCGVPLICFSLLTDQFTNRKLVVDDWKVGINLCEGHLVENEEVTKKVKDLMIIGAKSNELREEMKKIKTTLQDALVLGGSSQQNFDGFIREVKVKINNMK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G543940`
TK1151 ID	TkA02G543940
OH-1004 ID	LXL04_012706
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.700
Protein coverage (%)	TK1151 93.805 / OH-1004 15.043 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G543940

Location Chr02:140284013-140284354 (+)

Description Similar to UGT86A1: UDP-glycosyltransferase 86A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36970`	UDP-glycosyltransferase 86A1.	No verified direct reference in this release
`At2g28080`	UDP-glycosyltransferase 86A2.	No verified direct reference in this release
`At4g14090`	Catalyzes the glycosylation of anthocyanins from UDP-glucose.	Functional genomics by integrated analysis of metabolome and transcriptome of Arabidopsis plants over-expressing an MYB transcription factor.2005 · DOI: 10.1111/j.1365-313x.2005.02371.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012706 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0015020 glucuronosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0050403 trans-zeatin O-beta-D-glucosyltransferase activity Molecular Function

GO:0050502 cis-zeatin O-beta-D-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G22400

ath:AT2G28080

ath:AT2G36970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.429

Rank 1 · TkA02G543940 · TK1151

Cytoplasm0.242

Rank 2 · TkA02G543940 · TK1151

Endoplasmic reticulum0.128

Rank 3 · TkA02G543940 · TK1151

Mitochondrion0.074

Rank 4 · TkA02G543940 · TK1151

Plastid0.055

Rank 5 · TkA02G543940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201UDPGT1-41 aa

PF04101Glyco_tran_28_C2-79 aa

PF28417SKA3_helical52-64 aa

PF28417SKA3_helical72-107 aa

PF04101Glyco_tran_28_C88-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G543940	`PF00201`	UDPGT	1	41	1.1e-07	31.8
TkA02G543940	`PF04101`	Glyco_tran_28_C	2	79	0.011	16.5
TkA02G543940	`PF28417`	SKA3_helical	52	64	0.037	14.9
TkA02G543940	`PF28417`	SKA3_helical	72	107	0.037	14.9
TkA02G543940	`PF04101`	Glyco_tran_28_C	88	107	0.011	16.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJL0`	Arabidopsis thaliana	sp\|Q9SJL0\|U86A1_ARATH UDP-glycosyltransferase 86A1	57.400%	Swiss-Prot	High
`Q9ZUV0`	Arabidopsis thaliana	sp\|Q9ZUV0\|U86A2_ARATH UDP-glycosyltransferase 86A2	47.700%	Swiss-Prot	Medium
`Q0WW21`	Arabidopsis thaliana	sp\|Q0WW21\|U75C1_ARATH UDP-glycosyltransferase 75C1	40.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card