TkA02G541270 | RubberDandelionOmics

Gene overview

TkA02G541270

Reference: TK1151 Chr: Chr02 Coordinates: 139664521-139667994 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1970 bp · TkA02G541270|TK1151|cDNA

TCCAGAACAAATTTTGGACAGATAAAACACGATGAGTGCCAGACGAATCTCCGTCTTCCAAAACCCTTCGTACTTGATCACTTCTTCCACTTGATTAGAAATTTGAACCCGCGAATTGAAAATCAATTCGTACTTATTTAACCCCTTTTGACAGGAAATTTTTTTTGCTTAGATTTTCCATGAAGAACCCATGTATATGATCTGTTTCTGAAGTCGGGTTTCAGAATTTTCTTACACAATAGATTCCAGAAACAGATGGA...

CDS

Download CDS FASTA

1479 bp · TkA02G541270|TK1151|CDS

ATGGAGATCGATAAAGCCATTAGAGATAGCGATGATCGAAGGCTGAAGGTCAAGTATAATAACGCCATTTATGTTATTCAAAGAGCTCTTGCCCTCTACTCTATCGAAGAGGTTGCATTCAGCTTCAATGGAGGAAAGGATTCAACGGTTTTGTTGCACCTACTTAGGGCAGGATACTTCTTGCATCAAGTGGAACACGGCCATTCAAATGGGGATCCATCTGATCATAACTTTACTTTTCCAATAAGAACAATATATTT...

Protein

Download Protein FASTA

492 aa · TkA02G541270|TK1151|PROTEIN

MEIDKAIRDSDDRRLKVKYNNAIYVIQRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYFLHQVEHGHSNGDPSDHNFTFPIRTIYFESPSAFPEINSFTYETAASYGVQLDILRQDFKSGLEALLKVKKTRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYRDVWAFLLTCNVSYCGLYDQGYTSIGSINDTVPNGLLCINDSAKTFRPAYMLSDGRLERAGRAKKSTQVNNGLKNTQPHQTTLTASII...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G541270`
TK1151 ID	TkA02G541270
OH-1004 ID	LXL04_012725
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G541270

Location Chr02:139664521-139667994 (+)

Description Similar to Flad1: FAD synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03430`	Catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.	A higher plant FAD synthetase is fused to an inactivated FAD pyrophosphatase.2022 · DOI: 10.1016/j.jbc.2022.102626

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012725 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006747 FAD biosynthetic process Biological Process

GO:0006771 riboflavin metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003919 FMN adenylyltransferase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0035529 NADH pyrophosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0047884 FAD diphosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT5G03430

cre:CHLRE_13g592500v5

pon:100453995

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.737

Rank 1 · TkA02G541270 · TK1151

Nucleus0.410

Rank 2 · TkA02G541270 · TK1151

Mitochondrion0.083

Rank 3 · TkA02G541270 · TK1151

Peroxisome0.040

Rank 4 · TkA02G541270 · TK1151

Cell membrane0.029

Rank 5 · TkA02G541270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01507PAPS_reduct38-205 aa

PF00994MoCF_biosynth259-354 aa

PF24102FLAD1_M419-486 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G541270	`PF01507`	PAPS_reduct	38	205	3.8e-24	86.4
TkA02G541270	`PF00994`	MoCF_biosynth	259	354	3.3e-16	60.0
TkA02G541270	`PF24102`	FLAD1_M	419	486	2.9e-08	34.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZE4`	Arabidopsis thaliana	sp\|Q9LZE4\|FAD1_ARATH Bifunctional cytosolic FAD synthase/FAD diphosphatase-like	68.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card