TkA02G538920 | RubberDandelionOmics

Gene overview

TkA02G538920

Reference: TK1151 Chr: Chr02 Coordinates: 138991150-138991905 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

672 bp · TkA02G538920|TK1151|cDNA

ATGGCGATCTCTTTGTTCTTATTTCCATCACCACCTTCCTTGTTAGTTAATGTTATGTCGATCTTAAACTTGGTGGCTCTCATGACTGCGGGTTACATGGAAATGATAGGCAAAAACAAGCAATACGCCAAGTTTTTTAATGCTGCTGGTTCAAACAACCGTAAGTTGTCTAGTAAAATCGGAATGCTTGTGTTCTATACACCATCTTTCTTCTTGGGTGTTGCCTCTTTTGTTGTTTTCCCCCATCAAGATCTTCGATT...

CDS

Download CDS FASTA

672 bp · TkA02G538920|TK1151|CDS

ATGGCGATCTCTTTGTTCTTATTTCCATCACCACCTTCCTTGTTAGTTAATGTTATGTCGATCTTAAACTTGGTGGCTCTCATGACTGCGGGTTACATGGAAATGATAGGCAAAAACAAGCAATACGCCAAGTTTTTTAATGCTGCTGGTTCAAACAACCGTAAGTTGTCTAGTAAAATCGGAATGCTTGTGTTCTATACACCATCTTTCTTCTTGGGTGTTGCCTCTTTTGTTGTTTTCCCCCATCAAGATCTTCGATT...

Protein

Download Protein FASTA

223 aa · TkA02G538920|TK1151|PROTEIN

MAISLFLFPSPPSLLVNVMSILNLVALMTAGYMEMIGKNKQYAKFFNAAGSNNRKLSSKIGMLVFYTPSFFLGVASFVVFPHQDLRFVMVISVLTIRFFKRTLEVLFIHKFSGSMMVEAAITIGLSYFVSTATMIYAQFLSQESPKPAFDLKYVGVAMFLTGISGNFYHHYILSSLRKKGDKEYKIPKGGLFHLVICPHYMFEIVEFVGVSCICQTGLRVVLH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G538920`
TK1151 ID	TkA02G538920
OH-1004 ID	LXL04_012784
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 97.309 / OH-1004 83.142 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G538920`
Location	Chr02:138991150-138991905 (+)
Description	Similar to DET2: Steroid 5-alpha-reductase DET2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012784` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006665 sphingolipid metabolic process Biological Process GO:0006694 steroid biosynthetic process Biological Process GO:0009416 response to light stimulus Biological Process GO:0010268 brassinosteroid homeostasis Biological Process GO:0016132 brassinosteroid biosynthetic process Biological Process GO:0030497 fatty acid elongation Biological Process GO:0042761 very long-chain fatty acid biosynthetic process Biological Process GO:0090377 seed trichome initiation Biological Process GO:0090378 seed trichome elongation Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component
KEGG gene cross-reference	ath:AT2G38050 bdi:100827766 cel:CELE_C15F1.6 ddi:DDB_G0270270 ghi:107948867 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.875

Rank 1 · TkA02G538920 · TK1151

Nucleus0.076

Rank 2 · TkA02G538920 · TK1151

Cytoplasm0.057

Rank 3 · TkA02G538920 · TK1151

Golgi apparatus0.044

Rank 4 · TkA02G538920 · TK1151

Cell membrane0.040

Rank 5 · TkA02G538920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06966DUF129516-45 aa

PF02544Steroid_dh24-44 aa

PF06966DUF1295127-215 aa

PF02544Steroid_dh131-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G538920	`PF06966`	DUF1295	16	45	0.0025	18.1
TkA02G538920	`PF02544`	Steroid_dh	24	44	3.4e-17	63.5
TkA02G538920	`PF06966`	DUF1295	127	215	0.0025	18.1
TkA02G538920	`PF02544`	Steroid_dh	131	213	3.4e-17	63.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card