TkA02G537110 | RubberDandelionOmics

Gene overview

TkA02G537110

Reference: TK1151 Chr: Chr02 Coordinates: 138492994-138498531 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3175 bp · TkA02G537110|TK1151|cDNA

ATTGTATTATTTATACAGGAACATGAACGTTACCAAATTTCGAGACCTCGATCCGCAAAAACTTGATTTCACTATCAAAGTTCGTGTTTTGAAAAAATAGAATATTCCATCTAGATACAATGAGAACGAGGTGTGGTTAACTGAAATGATTCTCATGGATGAAGAGGGTGATGTTATTCAAGCCACGTTGTCTAAGAACCTATTCTACAAATTCCAGAAGCAACTGCGAGAAGGTTCTGATTATCTGATTGCATCACCTA...

CDS

Download CDS FASTA

3030 bp · TkA02G537110|TK1151|CDS

ATGATTCTCATGGATGAAGAGGGTGATGTTATTCAAGCCACGTTGTCTAAGAACCTATTCTACAAATTCCAGAAGCAACTGCGAGAAGGTTCTGATTATCTGATTGCATCACCTACACTTGGAGAGCAAAATCCAAATTTCTTACTCCGCGAGCAAAAAAACAAAATTACTTTCCTCAAAACAACAATTCTTATCAATTCACCCAACTTTACCACCACCAGTAATGGTTTCTCTTTCGTGGATTTTCCACTTATTTTATC...

Protein

Download Protein FASTA

1009 aa · TkA02G537110|TK1151|PROTEIN

MILMDEEGDVIQATLSKNLFYKFQKQLREGSDYLIASPTLGEQNPNFLLREQKNKITFLKTTILINSPNFTTTSNGFSFVDFPLILSDEFPLNQSIDVIGALKGKPELDTTKQIHLLPIKLQDLHGNIIEVSLWKDLAHQLNDFITQNQDRSHVIVALQFGKKHLYNGKQSVTSWWDHSKLFVNKDWPEINKFKESYLARYGSEVSSTAVSELSSTSIQTFIIVGKIVSIRQDQEWYYLSCTACPSKVTEKWLTKDLPDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G537110`
TK1151 ID	TkA02G537110
OH-1004 ID	LXL04_030158
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	72.700
Protein coverage (%)	TK1151 51.338 / OH-1004 58.165 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G537110`
Location	Chr02:138492994-138498531 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030158` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · TkA02G537110 · TK1151

Cytoplasm0.124

Rank 2 · TkA02G537110 · TK1151

Mitochondrion0.021

Rank 3 · TkA02G537110 · TK1151

Cell membrane0.013

Rank 4 · TkA02G537110 · TK1151

Endoplasmic reticulum0.006

Rank 5 · TkA02G537110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02721DUF2231-88 aa

PF01336tRNA_anti-codon2-33 aa

PF16900REPA_OB_292-171 aa

PF08646Rep_fac-A_C109-141 aa

PF01336tRNA_anti-codon119-146 aa

PF02721DUF223120-149 aa

PF02721DUF223211-237 aa

PF08646Rep_fac-A_C222-369 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G537110	`PF02721`	DUF223	1	88	6.6e-08	33.5
TkA02G537110	`PF01336`	tRNA_anti-codon	2	33	0.16	12.6
TkA02G537110	`PF16900`	REPA_OB_2	92	171	0.00096	19.8
TkA02G537110	`PF08646`	Rep_fac-A_C	109	141	7.1e-08	33.1
TkA02G537110	`PF01336`	tRNA_anti-codon	119	146	0.16	12.6
TkA02G537110	`PF02721`	DUF223	120	149	6.6e-08	33.5
TkA02G537110	`PF02721`	DUF223	211	237	6.6e-08	33.5
TkA02G537110	`PF08646`	Rep_fac-A_C	222	369	7.1e-08	33.1
TkA02G537110	`PF16900`	REPA_OB_2	278	315	0.00096	19.8
TkA02G537110	`PF01336`	tRNA_anti-codon	291	309	0.16	12.6
TkA02G537110	`PF14214`	Helitron_like_N	371	446	7.2e-46	157.5
TkA02G537110	`PF14214`	Helitron_like_N	844	1008	7.2e-46	157.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card