TkA02G535740 | RubberDandelionOmics

Gene overview

TkA02G535740

Reference: TK1151 Chr: Chr02 Coordinates: 138153965-138158564 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2798 bp · TkA02G535740|TK1151|cDNA

AAACTGGGAGGGTCCAATATATAACATAAAGTTTTTTGAGGTAGTCAAAGTATAAAGTTTACTATTGTTGCAGTTTCGTTAAACCCTAGTTATCTCCCTGCTTCTCTAAACCTCAGAGCCAGAGGCTGTAAGAGAGGTCGAGTCGGAGGTCTCACAGCAATGGCGGCATTTGACCATGTTCAAAATATGCATGACATCGCTCTAAAACCTAGACTTCTTCGTTCGTTAATTAAAGAACACATCCCTGACGAGAAACATCA...

CDS

Download CDS FASTA

2313 bp · TkA02G535740|TK1151|CDS

ATGGCGGCATTTGACCATGTTCAAAATATGCATGACATCGCTCTAAAACCTAGACTTCTTCGTTCGTTAATTAAAGAACACATCCCTGACGAGAAACATCAGTTGGGAAATCCATTAGAGCTCTCACAACTCGTATCCTCTATTAAAACTCACGAACTGCTGTCGGAACGTGTTGTGCAAACTGGAGATAACAAGAAATTGGTTGAAAAATGGAAATCCGCAGTTGATTTGTGGATTGATCGTTTGCTCATGCTAGTCTC...

Protein

Download Protein FASTA

770 aa · TkA02G535740|TK1151|PROTEIN

MAAFDHVQNMHDIALKPRLLRSLIKEHIPDEKHQLGNPLELSQLVSSIKTHELLSERVVQTGDNKKLVEKWKSAVDLWIDRLLMLVSSNMPDKCWAGICLLGVTCEECSPERFLSSYSAWFQKLLSHLQPLAESHFVKVACCVSISDILTRLSGFPNMKKDGTSHAARVIQPLLKLMQEDNSSDAEGAVRLLSTILNSFPSSLQKFYDSVESAIVTKLIYGKCNPNMLKKLAVCLSLLPKSKGDEDSWSVLFQKLLIAIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G535740`
TK1151 ID	TkA02G535740
OH-1004 ID	LXL04_012838
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G535740`
Location	Chr02:138153965-138158564 (-)
Description	Similar to pelp1: Proline-, glutamic acid- and leucine-rich protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012838` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006364 rRNA processing Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0071391 cellular response to estrogen stimulus Biological Process GO:0000791 euchromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0071339 MLL1 complex Cellular Component GO:0003682 chromatin binding Molecular Function
KEGG gene cross-reference	xla:733329 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.935

Rank 1 · TkA02G535740 · TK1151

Cytoplasm0.122

Rank 2 · TkA02G535740 · TK1151

Cell membrane0.032

Rank 3 · TkA02G535740 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA02G535740 · TK1151

Golgi apparatus0.013

Rank 5 · TkA02G535740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08167RIX119-221 aa

PF24714TOR1L1_N122-202 aa

PF26706TPR_DOP1B162-219 aa

PF24714TOR1L1_N489-513 aa

PF22041GST_C_7504-554 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G535740	`PF08167`	RIX1	19	221	2.8e-40	138.8
TkA02G535740	`PF24714`	TOR1L1_N	122	202	0.12	12.4
TkA02G535740	`PF26706`	TPR_DOP1B	162	219	0.071	13.5
TkA02G535740	`PF24714`	TOR1L1_N	489	513	0.12	12.4
TkA02G535740	`PF22041`	GST_C_7	504	554	0.034	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card