TkA02G535650 | RubberDandelionOmics

Gene overview

TkA02G535650

Reference: TK1151 Chr: Chr02 Coordinates: 138135349-138138494 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

719 bp · TkA02G535650|TK1151|cDNA

CAAGTGCGAATGTGAGGCTGTGAGCTTGCGTTCCCCTTTGAAGCAGATGGCGGGAACGGTTAAAACCCTTACGAATCTTATTTCTCCGGTAACAGTAACCGCTCATCTCCGATCGCGGAAATCACAATACAATAATCGGTCATTCGATGTTATTAATAACTCGTTGATATCTCGAAAGGTCCGTACAGTTAGAACGCTCATCATCAGAAGCCACACAAATTCCGATCAGGTTTCAGGAACTGGCGGTCCAGATGAATCTC...

CDS

Download CDS FASTA

1266 bp · TkA02G535650|TK1151|CDS

ATGGCGGGAACGGTTAAAACCCTTACGAATCTTATTTCTCCGGTAACAGTAACCGCTCATCTCCGATCGCGGAAATCACAATACAATAATCGGTCATTCGATGTTATTAATAACTCGTTGATATCTCGAAAGGTCCGTACAGTTAGAACGCTCATCATCAGAAGCCACACAAATTCCGATCAGGTTTCAGGAACTGGCGGTCCAGATGAATCTCCTCGCAGATCTGGTTTCTCGAGCTTTCCAGTCCTAGCAGAACCTTT...

Protein

Download Protein FASTA

421 aa · TkA02G535650|TK1151|PROTEIN

MAGTVKTLTNLISPVTVTAHLRSRKSQYNNRSFDVINNSLISRKVRTVRTLIIRSHTNSDQVSGTGGPDESPRRSGFSSFPVLAEPLLSFASSNFLPLALIGGVALGLANPGPGCLAHRYQLSIVSTFGIFIISGLRLRSEDIGAAVKAWPVGLFGLASILLFTPLLSRVILQLHFQPQEFVTGLALFSCMPTTLSSGVALTRLAGGNCALALAMTVTSSLLAILMVPFSISKLIASGLGASVPTEQLFRRLILTLLIPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G535650`
TK1151 ID	TkA02G535650
OH-1004 ID	LXL04_012843
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 98.364 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G535650

Location Chr02:138135349-138138494 (+)

Description Similar to BASS4: Probable sodium/metabolite cotransporter BASS4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56160`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AJ09`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release
`Os02g0531200`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012843 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006814 sodium ion transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0015293 symporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G56160

dosa:Os02g0531200

dre:445025

xtr:448418

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.981

Rank 1 · TkA02G535650 · TK1151

Peroxisome0.023

Rank 2 · TkA02G535650 · TK1151

Cell membrane0.022

Rank 3 · TkA02G535650 · TK1151

Nucleus0.017

Rank 4 · TkA02G535650 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkA02G535650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13593SBF_like96-412 aa

PF01758SBF134-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G535650	`PF13593`	SBF_like	96	412	2.5e-41	142.7
TkA02G535650	`PF01758`	SBF	134	297	1.7e-17	64.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IZC4`	Arabidopsis thaliana	sp\|F4IZC4\|BASS4_ARATH Probable sodium/metabolite cotransporter BASS4, chloroplastic	64.600%	Swiss-Prot	High
`B8AJ09`	Oryza sativa subsp. indica	sp\|B8AJ09\|BASS4_ORYSI Probable sodium/metabolite cotransporter BASS4, chloroplastic	62.400%	Swiss-Prot	High
`Q6ESG1`	Oryza sativa subsp. japonica	sp\|Q6ESG1\|BASS4_ORYSJ Probable sodium/metabolite cotransporter BASS4, chloroplastic	62.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card