RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G535510
Reference: TK1151 Chr: Chr02 Coordinates: 138086955-138095700 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2799 bp · TkA02G535510|TK1151|cDNA

AATGAAGAAAAGTGTCTCCATGAGAACACTTTGACCTTTTTCATGTATCTTAACACTGAAGTAACGAAAGAAGAAAACCCGTAAATGTTGCCACGAATTTTATAACTACATGGGCCAAAAAGAATAACAGACCCTTTCCGTAAAACATCTTTCCCATTGAAATCCAAGTTCGAATTGGAAATCACAGATCCTAAATAAGTTCTAACCCTCTTTTTGAAGTACTTATTTCTGTACATCTTATCGCAACCACGCTGTAACTC...

CDS

Download CDS FASTA

1341 bp · TkA02G535510|TK1151|CDS

ATGCCTATAGATGACAACAGCCCTAGTGCTCGCAGTCTTGGCTCCCTCTCCAACACCACCACCGATCTCTTGAAGCTGAGCACAAGCTCAAGAAGCGAATCTCCGGTCGAAAACTTAAGCCGCTCCTTCTCTTCCTACCGTCCTACCCCACCATCCTCCTCCACCACCACCAAGGAAACGATAAGCCAGCTGGTGAAGGCCAATGGTGGTACTCTCAGTCTCGATGAACTGAGATTCGTACAAAGGCTAGGGAGTGGCGA...

Protein

Download Protein FASTA

446 aa · TkA02G535510|TK1151|PROTEIN

MPIDDNSPSARSLGSLSNTTTDLLKLSTSSRSESPVENLSRSFSSYRPTPPSSSTTTKETISQLVKANGGTLSLDELRFVQRLGSGDIGSVYLVELKCAEGCMLAAKVMDKEELMNREKEGRARIELEVLQMLDHPFLPSLYANLEVDRWSCLLTEFCPGGDLHILRQRQPDRRFDESAVRFYASEVVVALEYLHMMGIIYRDLKPENVLVRSDGHIMLTDFDLCLKCDDPTTPKLLQGQELAIASPSTALCTKGSFSPC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G535510
TK1151 IDTkA02G535510
OH-1004 IDLXL04_012849
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.600
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G535510
LocationChr02:138086955-138095700 (+)
DescriptionSimilar to D6PKL2: Serine/threonine-protein kinase D6PKL2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g26610 Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.
D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484
At5g47750 Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.
D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484
At5g55910 Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.
The polarly localized D6 PROTEIN KINASE is required for efficient auxin transport in Arabidopsis thaliana.2009 · DOI: 10.1242/dev.028365
D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484
Arabidopsis D6PK is a lipid domain-dependent mediator of root epidermal planar polarity.2015 · DOI: 10.1038/nplants.2015.162

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2YBX5 May play a role in the regulation of metabolism and signal transduction processes. No verified direct reference in this release
Os06g0291600 May play a role in the regulation of metabolism and signal transduction processes. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_012849 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0009638 phototropism Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0009860 pollen tube growth Biological Process
GO:0010540 basipetal auxin transport Biological Process
GO:0005634 nucleus Cellular Component
GO:0005730 nucleolus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT1G79250
ath:AT4G26610
ath:AT5G47750
dosa:Os06g0291600
osa:4340792
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.574
Rank 1 · TkA02G535510 · TK1151
Nucleus0.450
Rank 2 · TkA02G535510 · TK1151
Cell membrane0.083
Rank 3 · TkA02G535510 · TK1151
Mitochondrion0.051
Rank 4 · TkA02G535510 · TK1151
Endoplasmic reticulum0.037
Rank 5 · TkA02G535510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr78-229 aa
PF00069Pkinase79-232 aa
PF03109ABC1151-234 aa
PF06293Kdo162-225 aa
PF14531Kinase-like187-224 aa
PF07714PK_Tyr_Ser-Thr271-283 aa
PF00069Pkinase304-407 aa
PF07714PK_Tyr_Ser-Thr312-392 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G535510PF07714PK_Tyr_Ser-Thr782291.6e-2797.1
TkA02G535510PF00069Pkinase792323.8e-54184.6
TkA02G535510PF03109ABC11512340.01814.9
TkA02G535510PF06293Kdo1622250.1312.4
TkA02G535510PF14531Kinase-like1872240.02114.8
TkA02G535510PF07714PK_Tyr_Ser-Thr2712831.6e-2797.1
TkA02G535510PF00069Pkinase3044073.8e-54184.6
TkA02G535510PF07714PK_Tyr_Ser-Thr3123921.6e-2797.1
TkA02G535510PF14531Kinase-like3273480.02114.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SUA3Arabidopsis thalianasp|Q9SUA3|D6KL1_ARATH Serine/threonine-protein kinase D6PKL150.400%Swiss-ProtHigh
Q39183Arabidopsis thalianasp|Q39183|D6KL2_ARATH Serine/threonine-protein kinase D6PKL251.500%Swiss-ProtHigh
Q9FG74Arabidopsis thalianasp|Q9FG74|D6PK_ARATH Serine/threonine-protein kinase D6PK51.300%Swiss-ProtHigh
A2YBX5Oryza sativa subsp. indicasp|A2YBX5|G11A_ORYSI Protein kinase G11A51.400%Swiss-ProtHigh
Q0DCT8Oryza sativa subsp. japonicasp|Q0DCT8|G11A_ORYSJ Protein kinase G11A51.400%Swiss-ProtHigh

JBrowse

View in Genome Browser