TkA02G532450 | RubberDandelionOmics

Gene overview

TkA02G532450

Reference: TK1151 Chr: Chr02 Coordinates: 137232377-137233239 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

704 bp · TkA02G532450|TK1151|cDNA

AGATAATATTTTTTCTACGATTGTCTATTTATCACTATCATTGGAAAGTTTCTTTTGTAAAACCCTACCTGTAAACGCTCGGTATTGTCATATTTGGCTTTCTTCTTGCTGCTTCTTCTTAGTCTTTTTGTGTTGTGGATTTAGGGTTTATGGTATTTAGGGCGTTCTGTGGCCACTAATTCCTTTATTTCATCTACCTGATTCTCTAATTATAATTTGACGTTACAAACCTCCCTAAATCCCTTATCGCTTTCAAAATT...

CDS

Download CDS FASTA

360 bp · TkA02G532450|TK1151|CDS

ATGACTTTTGAAAGAGGCGACAGGGTTGAAATTTCAAACAAAGAAGAGGGTCTTGCGGGTTCATACTACCTAGCAAACATCATCTCTTCGCTTTCCAAAAAAGACTACATTATCCAGTACAGAACCTTTTTAAATGACGACGGTTTTGGGCCTTTAAGAGAGATTGTTTCTGTCGATCAAATCCGGCCACTTCCTCCGGAGATTCCGGCGACTGAGTTTTCTTTGTTAGACATGGTTGACGCCTACGACAATGATGGTTG...

Protein

Download Protein FASTA

120 aa · TkA02G532450|TK1151|PROTEIN

MTFERGDRVEISNKEEGLAGSYYLANIISSLSKKDYIIQYRTFLNDDGFGPLREIVSVDQIRPLPPEIPATEFSLLDMVDAYDNDGWWVGKIVRKMGSNYLVFFKNSREEIDYPLTRLRV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G532450`
TK1151 ID	TkA02G532450
OH-1004 ID	LXL04_012887
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 93.023 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G532450

Location Chr02:137232377-137233239 (-)

Description Similar to AGDP1: Protein AGENET DOMAIN (AGD)-CONTAINING P1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09320`	Heterochromatin-binding protein that preferentially occupies long transposons and specifically recognizes the histone H3 'Lys-9' methylation (H3K9me) marks, with a stronger affinity for dimethylated H3K9 (H3K9me2).	Arabidopsis AGDP1 links H3K9me2 to DNA methylation in heterochromatin.2018 · DOI: 10.1038/s41467-018-06965-w Plant HP1 protein ADCP1 links multivalent H3K9 methylation readout to heterochromatin formation.2019 · DOI: 10.1038/s41422-018-0104-9

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012887 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000775 chromosome, centromeric region Cellular Component

GO:0000792 heterochromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0042393 histone binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0140566 histone reader activity Molecular Function

KEGG gene cross-reference

ath:AT1G09320

ath:AT1G11420

ath:AT1G26540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.758

Rank 1 · TkA02G532450 · TK1151

Cytoplasm0.437

Rank 2 · TkA02G532450 · TK1151

Endoplasmic reticulum0.031

Rank 3 · TkA02G532450 · TK1151

Cell membrane0.029

Rank 4 · TkA02G532450 · TK1151

Mitochondrion0.020

Rank 5 · TkA02G532450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00018SH3_11-17 aa

PF05641Agenet6-66 aa

PF05552MS_channel_1st_121-31 aa

PF05641Agenet77-108 aa

PF00018SH3_182-95 aa

PF05552MS_channel_1st_186-101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G532450	`PF00018`	SH3_1	1	17	0.0074	16.6
TkA02G532450	`PF05641`	Agenet	6	66	1.1e-22	80.9
TkA02G532450	`PF05552`	MS_channel_1st_1	21	31	0.15	12.6
TkA02G532450	`PF05641`	Agenet	77	108	1.1e-22	80.9
TkA02G532450	`PF00018`	SH3_1	82	95	0.0074	16.6
TkA02G532450	`PF05552`	MS_channel_1st_1	86	101	0.15	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q500V5`	Arabidopsis thaliana	sp\|Q500V5\|AGDP1_ARATH Protein AGENET DOMAIN (AGD)-CONTAINING P1	31.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card