TkA02G531740 | RubberDandelionOmics

Gene overview

TkA02G531740

Reference: TK1151 Chr: Chr02 Coordinates: 137098252-137099027 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

489 bp · TkA02G531740|TK1151|cDNA

ATGTTAAACTTCTTTGATCCGCTCAACAACCCTAATCGGTGTTTAGGTTCCAAAATGGTTAAAATCATAGCTGGTTCCCGAGTGGAGGTTATGCGTCCATCCCGTGGGTTTGAAAATTCATACTTTGGTGCACAAGTCATAAGAAGAAACCAAACTATAGCTTTGGTAAGATATGAAGAGCTCATTGATGACAATGGTGAACTGCTGGTGGAGAAGCGCAGAATTGAGCACATTAGACCGTACCCGCCAAGAGTTGACCA...

CDS

Download CDS FASTA

489 bp · TkA02G531740|TK1151|CDS

ATGTTAAACTTCTTTGATCCGCTCAACAACCCTAATCGGTGTTTAGGTTCCAAAATGGTTAAAATCATAGCTGGTTCCCGAGTGGAGGTTATGCGTCCATCCCGTGGGTTTGAAAATTCATACTTTGGTGCACAAGTCATAAGAAGAAACCAAACTATAGCTTTGGTAAGATATGAAGAGCTCATTGATGACAATGGTGAACTGCTGGTGGAGAAGCGCAGAATTGAGCACATTAGACCGTACCCGCCAAGAGTTGACCA...

Protein

Download Protein FASTA

162 aa · TkA02G531740|TK1151|PROTEIN

MLNFFDPLNNPNRCLGSKMVKIIAGSRVEVMRPSRGFENSYFGAQVIRRNQTIALVRYEELIDDNGELLVEKRRIEHIRPYPPRVDQVLNEGDHVDAWDGAGWWRGRILLECKHDYVVYFNYMKKKSTGKSRMQKIVFEYTKNARISVVGLHGFMSRLTHEN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G531740`
TK1151 ID	TkA02G531740
OH-1004 ID	LXL04_019108
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 68.519 / OH-1004 28.101 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G531740`
Location	Chr02:137098252-137099027 (-)
Description	Similar to RCE2: Probable NEDD8-conjugating enzyme Ubc12-like
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019108` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009733 response to auxin Biological Process GO:0036211 protein modification process Biological Process GO:0045116 protein neddylation Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0016604 nuclear body Cellular Component GO:0004842 ubiquitin-protein transferase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0019787 ubiquitin-like protein transferase activity Molecular Function
KEGG gene cross-reference	ath:AT2G18600 ath:AT4G36800 mmu:22192 xla:446800 xtr:394553 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.671

Rank 1 · TkA02G531740 · TK1151

Cytoplasm0.318

Rank 2 · TkA02G531740 · TK1151

Cell membrane0.057

Rank 3 · TkA02G531740 · TK1151

Endoplasmic reticulum0.047

Rank 4 · TkA02G531740 · TK1151

Mitochondrion0.031

Rank 5 · TkA02G531740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05641Agenet25-83 aa

PF05641Agenet94-137 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G531740	`PF05641`	Agenet	25	83	2.2e-13	51.2
TkA02G531740	`PF05641`	Agenet	94	137	2.2e-13	51.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card