Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1333 bp · TkA02G530740|TK1151|cDNA
CTTTCCCGCCAGTTCTTCATTCACTGTCACCGGCACACATCCTCTTCCAGACCTTGAAAGATGCTGTGGGTGGACAAATACAGGCCAAAATCCCTCGACAAGGTTCTTGTACATGAAGATATCGCTCAAAATCTCAAGAAATTGGTCACGGAGCAGGATTGCCCACACTTACTGTTCTATGGCCCATCCGGTTCCGGGAAGAAAACCCTAATTATGGCCCTTCTCAGGCAGATGTTCGGGGCTGGTGCCGAGAAGGTGAA...
780 bp · TkA02G530740|TK1151|CDS
ATGCTGTGGGTGGACAAATACAGGCCAAAATCCCTCGACAAGGTTCTTGTACATGAAGATATCGCTCAAAATCTCAAGAAATTGGTCACGGAGCAGGATTGCCCACACTTACTGTTCTATGGCCCATCCGGTTCCGGGAAGAAAACCCTAATTATGGCCCTTCTCAGGCAGATGTTCGGGGCTGGTGCCGAGAAGGTGAAAGTGGAGAACAAAAACTGGAAAGTTGATGCTGGAAGCAGAACTATCGATTTGGAACTCAC...
Protein
Download Protein FASTA259 aa · TkA02G530740|TK1151|PROTEIN
MLWVDKYRPKSLDKVLVHEDIAQNLKKLVTEQDCPHLLFYGPSGSGKKTLIMALLRQMFGAGAEKVKVENKNWKVDAGSRTIDLELTTLSSTNHVELNPSDAGFQDRYVVQEIIKEMAKNRPIDTKGKKTFKVLVLNEVDKLSREAQHSLRRTMEKYSASCRLILCCDSSSKVTEAVRSRCLNIRVNAPKEDQIVKVLEFIGKKEGLQLPPGFAARIAEKSGRSLRRAILSFETCRVKQYPFTNNQVIPPMDGKNMYVR
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G530740 |
|---|---|
| TK1151 ID | TkA02G530740 |
| OH-1004 ID | LXL04_012916 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 97.297 / OH-1004 71.186Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G530740 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:136846876-136849167 (-) | ||||||||||||
| Description | Similar to RFC3: Replication factor C subunit 3 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006260 DNA replication Biological Process GO:0006261 DNA-templated DNA replication Biological Process GO:0006271 DNA strand elongation involved in DNA replication Biological Process GO:0006272 leading strand elongation Biological Process GO:0006281 DNA repair Biological Process GO:1900264 positive regulation of DNA-directed DNA polymerase activity Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005663 DNA replication factor C complex Cellular Component GO:0031389 Rad17 RFC-like complex Cellular Component GO:0031390 Ctf18 RFC-like complex Cellular Component GO:0031391 Elg1 RFC-like complex Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT5G27740 bta:515602 ddi:DDB_G0293702 dosa:Os03g0792600 mmu:69263 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03215Rad172-58 aaPF05496RuvB_N8-58 aaPF00437T2SSE11-63 aaPF03193RsgA_GTPase14-57 aaPF01580FtsK_SpoIIIE14-55 aaPF13177DNA_pol3_delta218-187 aaPF05673DUF81518-71 aaPF14532Sigma54_activ_219-50 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G530740 | PF03215 | Rad17 | 2 | 58 | 4e-06 | 27.6 |
| TkA02G530740 | PF05496 | RuvB_N | 8 | 58 | 0.001 | 19.6 |
| TkA02G530740 | PF00437 | T2SSE | 11 | 63 | 0.1 | 12.0 |
| TkA02G530740 | PF03193 | RsgA_GTPase | 14 | 57 | 0.0043 | 17.6 |
| TkA02G530740 | PF01580 | FtsK_SpoIIIE | 14 | 55 | 0.11 | 12.6 |
| TkA02G530740 | PF13177 | DNA_pol3_delta2 | 18 | 187 | 3.4e-11 | 44.1 |
| TkA02G530740 | PF05673 | DUF815 | 18 | 71 | 0.00023 | 21.1 |
| TkA02G530740 | PF14532 | Sigma54_activ_2 | 19 | 50 | 2.5e-05 | 25.3 |
| TkA02G530740 | PF02367 | TsaE | 19 | 58 | 0.1 | 13.3 |
| TkA02G530740 | PF25199 | nSTAND_NTPase5 | 19 | 59 | 0.13 | 12.9 |
| TkA02G530740 | PF00931 | NB-ARC | 21 | 57 | 0.17 | 12.2 |
| TkA02G530740 | PF00158 | Sigma54_activat | 22 | 59 | 0.19 | 12.1 |
| TkA02G530740 | PF20703 | nSTAND1 | 23 | 76 | 0.18 | 12.1 |
| TkA02G530740 | PF01637 | ATPase_2 | 24 | 71 | 0.1 | 13.1 |
| TkA02G530740 | PF13086 | AAA_11 | 24 | 69 | 0.14 | 12.6 |
| TkA02G530740 | PF25201 | nSTAND6 | 25 | 71 | 0.00027 | 21.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.