TkA02G529960 | RubberDandelionOmics

Gene overview

TkA02G529960

Reference: TK1151 Chr: Chr02 Coordinates: 136666675-136671287 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2841 bp · TkA02G529960|TK1151|cDNA

TACCGGCGCGTGACCGGACGATAAATTTAACCGTTGGATTCCTGAGATCTGATCTACCCAGCTCAACCACCCACTCTCACCCACCCCCATCCTCTGCCTACCCCTCTCAAGCTTCTATAAATAATCGTATTCTCCATTCACTCCGATTCGTGTCAACCATTCTTCTCTCCTTTATCACCGGAAGAACGAAACAACTAGTCTCCTTCGAGACTCCTTTTGATTCGTGACTTCCTCTCCTACCGCCGTTTACAGAACAATGG...

CDS

Download CDS FASTA

2394 bp · TkA02G529960|TK1151|CDS

ATGATTTTAGTTCGATCACTGCTATGTTGCTTTGCCACAAGTCGAAGAACTTGCCATCTTGTTCAATTTTCTAAAATAGATCTGTGTTTTAGAACAATGGCATCTCACATTGTTGGTTATCCCCGTATGGGCCCCAAGAGAGAGCTGAAATTCGCTCTTGAATCCTTCTGGGATGGCAAGAGCAGTGCTGAGGATTTGCAGAAGGTGTCTGCTGATCTCAGATCATCCATCTGGAAACAGATGTCTGATGCTGGCATCAA...

Protein

Download Protein FASTA

797 aa · TkA02G529960|TK1151|PROTEIN

MILVRSLLCCFATSRRTCHLVQFSKIDLCFRTMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSDAGIKYIPSNTFSYYDQVLDTTAMLGAVPSRYNWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFIVPELGPDVQFSYASHKAVTEYKEAKALGVDTVPVFVGPVSYLLLSKPAKGVEKTFDLLSLLDKILPIYKEVIAELKEAGATTIQFDEATLVKDLESYQLEAFTKAYSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G529960`
TK1151 ID	TkA02G529960
OH-1004 ID	LXL04_012927
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 50.992 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G529960

Location Chr02:136666675-136671287 (-)

Description Similar to METE: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g17920`	Catalyzes the transfer of a methyl group from 5-methyltetrahydrofolate to homocysteine resulting in methionine formation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0624000`	Catalyzes the transfer of a methyl group from 5-methyltetrahydrofolate to homocysteine resulting in methionine formation.	No verified direct reference in this release
`Os12g0623900`	Catalyzes the transfer of a methyl group from 5-methyltetrahydrofolate to homocysteine resulting in methionine formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012927 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process

GO:0009086 methionine biosynthetic process Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0032259 methylation Biological Process

GO:0071266 'de novo' L-methionine biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ag:CAA58474

ath:AT5G17920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.790

Rank 1 · TkA02G529960 · TK1151

Nucleus0.260

Rank 2 · TkA02G529960 · TK1151

Peroxisome0.078

Rank 3 · TkA02G529960 · TK1151

Mitochondrion0.077

Rank 4 · TkA02G529960 · TK1151

Plastid0.066

Rank 5 · TkA02G529960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08267Meth_synt_135-348 aa

PF01717Meth_synt_2169-250 aa

PF01717Meth_synt_2464-787 aa

PF14512TM1586_NiRdase474-521 aa

PF08267Meth_synt_1476-521 aa

PF08267Meth_synt_1582-723 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G529960	`PF08267`	Meth_synt_1	35	348	2.6e-125	418.8
TkA02G529960	`PF01717`	Meth_synt_2	169	250	1.3e-163	544.7
TkA02G529960	`PF01717`	Meth_synt_2	464	787	1.3e-163	544.7
TkA02G529960	`PF14512`	TM1586_NiRdase	474	521	0.023	15.0
TkA02G529960	`PF08267`	Meth_synt_1	476	521	2.6e-125	418.8
TkA02G529960	`PF08267`	Meth_synt_1	582	723	2.6e-125	418.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O50008`	Arabidopsis thaliana	sp\|O50008\|METE1_ARATH 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 1	88.000%	Swiss-Prot	High
`Q2QLY4`	Oryza sativa subsp. japonica	sp\|Q2QLY4\|METE2_ORYSJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2	87.700%	Swiss-Prot	High
`Q2QLY5`	Oryza sativa subsp. japonica	sp\|Q2QLY5\|METE1_ORYSJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 1	87.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card