TkA02G529780 | RubberDandelionOmics

Gene overview

TkA02G529780

Reference: TK1151 Chr: Chr02 Coordinates: 136603052-136610288 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

3255 bp · TkA02G529780|TK1151|CDS

ATGGATCAGATAAACTTTCACAGTCAAAGGAAAATTCTCCAAGGTCCAGGTGGCAAGTCCTCAACAAGTGGGCCCTCCAAAGATCTATGGCTTGCAGTCCACGGAGGGTCTGTAATCGATGTAGATTCAGCCTTGGTCTCACTGAAGAAAAATGGTGGAAACATCAATTCAAGAAACACATTTGGGCTTACACCTCTTCATATTGCAACTTGGAGAAATCACATTCCAATCATCAGAAGACTTTTAGCAGCTGGTGCAGA...

Protein

Download Protein FASTA

1084 aa · TkA02G529780|TK1151|PROTEIN

MDQINFHSQRKILQGPGGKSSTSGPSKDLWLAVHGGSVIDVDSALVSLKKNGGNINSRNTFGLTPLHIATWRNHIPIIRRLLAAGADPNARDGESGWSSLHRALHFGHLAVASILLKSEASVAIEDSKSRTPVDLLSGPVLQANGNGDGSVTELYSWGSGVNYQLGTGNAHIQKLPCKVDSLHGSFIKSISSAKFHSVAVSAHGEVYTWGFGRGGRLGHPDFDIHSGQAAVITPRQVTSGLGARRVKAIAAAKHHTVAAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G529780`
TK1151 ID	TkA02G529780
OH-1004 ID	LXL04_012929
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 98.339 / OH-1004 99.627 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G529780

Location Chr02:136603052-136610288 (-)

Description Similar to ibtk: Inhibitor of Bruton tyrosine kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63860`	UV-B specific signaling component that acts as a UV-B photoreceptor and plays a key role in establishing UV-protective responses in plants.	A UV-B-specific signaling component orchestrates plant UV protection.2005 · DOI: 10.1073/pnas.0507187102 UV-B promotes rapid nuclear translocation of the Arabidopsis UV-B specific signaling component UVR8 and activates its function in the nucleus.2007 · DOI: 10.1105/tpc.107.053330 UV-B signaling pathways with different fluence-rate response profiles are distinguished in mature Arabidopsis leaf tissue by requirement for UVR8, HY5, and HYH.2008 · DOI: 10.1104/pp.107.108456 Interaction of COP1 and UVR8 regulates UV-B-induced photomorphogenesis and stress acclimation in Arabidopsis.2009 · DOI: 10.1038/emboj.2009.4 UVR8 in Arabidopsis thaliana regulates multiple aspects of cellular differentiation during leaf development in response to ultraviolet B radiation.2009 · DOI: 10.1111/j.1469-8137.2009.02855.x Negative feedback regulation of UV-B-induced photomorphogenesis and stress acclimation in Arabidopsis.2010 · DOI: 10.1073/pnas.0914532107 Functional interaction of the circadian clock and UV RESISTANCE LOCUS 8-controlled UV-B signaling pathways in Arabidopsis thaliana.2011 · DOI: 10.1111/j.1365-313x.2011.04573.x Perception of UV-B by the Arabidopsis UVR8 protein.2011 · DOI: 10.1126/science.1200660 UVR8 mediates UV-B-induced Arabidopsis defense responses against Botrytis cinerea by controlling sinapate accumulation.2012 · DOI: 10.1093/mp/sss025 C-terminal region of the UV-B photoreceptor UVR8 initiates signaling through interaction with the COP1 protein.2012 · DOI: 10.1073/pnas.1210898109 In vivo function of tryptophans in the Arabidopsis UV-B photoreceptor UVR8.2012 · DOI: 10.1105/tpc.112.101451 The UV-B photoreceptor UVR8 promotes photosynthetic efficiency in Arabidopsis thaliana exposed to elevated levels of UV-B.2012 · DOI: 10.1007/s11120-012-9785-y
`At5g60870`	Regulates DNA damage response (DDR) synergistically with ATM.	The RCC1 family protein RUG3 is required for splicing of nad2 and complex I biogenesis in mitochondria of Arabidopsis thaliana.2011 · DOI: 10.1111/j.1365-313x.2011.04658.x RUG3 and ATM synergistically regulate the alternative splicing of mitochondrial nad2 and the DNA damage response in Arabidopsis thaliana.2017 · DOI: 10.1038/srep43897 RUG3 is a negative regulator of plant responses to ABA in Arabidopsis thaliana.2017 · DOI: 10.1080/15592324.2017.1333217

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012929 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001933 negative regulation of protein phosphorylation Biological Process

GO:0009411 response to UV Biological Process

GO:0009649 entrainment of circadian clock Biological Process

GO:0010224 response to UV-B Biological Process

GO:0051209 release of sequestered calcium ion into cytosol Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT5G63860

hsa:25998

xla:431983

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.531

Rank 1 · TkA02G529780 · TK1151

Nucleus0.302

Rank 2 · TkA02G529780 · TK1151

Cell membrane0.192

Rank 3 · TkA02G529780 · TK1151

Golgi apparatus0.085

Rank 4 · TkA02G529780 · TK1151

Endoplasmic reticulum0.063

Rank 5 · TkA02G529780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00023Ank29-59 aa

PF13637Ank_444-78 aa

PF12796Ank_245-125 aa

PF13857Ank_551-103 aa

PF00023Ank62-92 aa

PF13606Ank_362-90 aa

PF13637Ank_473-116 aa

PF00023Ank96-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G529780	`PF00023`	Ank	29	59	1.8e-13	50.6
TkA02G529780	`PF13637`	Ank_4	44	78	1.7e-12	47.9
TkA02G529780	`PF12796`	Ank_2	45	125	1e-11	46.0
TkA02G529780	`PF13857`	Ank_5	51	103	4.6e-10	40.4
TkA02G529780	`PF00023`	Ank	62	92	1.8e-13	50.6
TkA02G529780	`PF13606`	Ank_3	62	90	8.3e-06	26.4
TkA02G529780	`PF13637`	Ank_4	73	116	1.7e-12	47.9
TkA02G529780	`PF00023`	Ank	96	126	1.8e-13	50.6
TkA02G529780	`PF13606`	Ank_3	96	120	8.3e-06	26.4
TkA02G529780	`PF13857`	Ank_5	98	135	4.6e-10	40.4
TkA02G529780	`PF25384`	Alsin_RLD	152	223	1e-15	58.5
TkA02G529780	`PF25390`	WD40_RLD	153	375	6.9e-82	276.4
TkA02G529780	`PF00415`	RCC1	153	200	1.6e-54	183.0
TkA02G529780	`PF13540`	RCC1_2	153	164	3e-26	91.2
TkA02G529780	`PF13540`	RCC1_2	187	211	3e-26	91.2
TkA02G529780	`PF08887`	GAD-like	190	211	0.23	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN03`	Arabidopsis thaliana	sp\|Q9FN03\|UVR8_ARATH Ultraviolet-B receptor UVR8	31.600%	Swiss-Prot	Low
`Q9FJG9`	Arabidopsis thaliana	sp\|Q9FJG9\|RUG3_ARATH RCC1 domain-containing protein RUG3, mitochondrial	30.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card