Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2290 bp · TkA02G529090|TK1151|cDNA
TGCAACATTGTGATCCTAATTATTTGAAAATTCAAGTGGCCCGCCCATAAGAGAAGAACGGACACGTTCTTCAGACAAGCTGCCAATCCAGATAAAACTAAAAAAAATACAAAAAATGAAAAACTTTCTATAAATATCCATCGTTCTCCACAACTTGACATTATCCCCTCTCTCTTTCTCTTTCTCTTGAGCTTCTCTAAATATCGCCACTGGTTCTTCATCGAGTACACACACTCCCATCTGCAATGGGGGTAAACAAC...
1890 bp · TkA02G529090|TK1151|CDS
ATGGGGGTAAACAACATCGGGAGATTGTCGGTTTTCTTGATTATAATGATCTGCTGGGCTTCCATGGCGGAAGCAGAGTACTTCAAATACAAAGATCCAAAACAGCCGCTAGGTGCTCGTATCAAAGATTTAATGAAAAGAATGACGGTAGAGGAAAAGATCGGCCAAATGACCCAAATCGATAGAACAGTTGCATCCAATGAAGTCATGAAGAAGTACTTAATAGGGAGTATATTGAGCGGAGGAGGGAGTGTTCCGGC...
Protein
Download Protein FASTA629 aa · TkA02G529090|TK1151|PROTEIN
MGVNNIGRLSVFLIIMICWASMAEAEYFKYKDPKQPLGARIKDLMKRMTVEEKIGQMTQIDRTVASNEVMKKYLIGSILSGGGSVPAKQASAEQWVDMVNDFQKGSLSTRLGIPMIYGIDAVHGHNNVYKSTIFPHNVGLGVTRDPVLVKKIGAATALEVRATGIQYAFAPCIAVCRDPRWGRCYESYSEDPKIVKLMTEIIPGLQGDIPAGSRKGVPFVGGQNKIAACAKHYLGDGGTHMGTNEGNTIIDPKGLFSIHM...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G529090 |
|---|---|
| TK1151 ID | TkA02G529090 |
| OH-1004 ID | LXL04_012931 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 98.900 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 96.918Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G529090 |
|---|---|
| Location | Chr02:136454510-136457999 (-) |
| Description | Similar to BACOVA_02659: Beta-glucosidase BoGH3B (Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009251 glucan catabolic process Biological Process GO:0031222 arabinan catabolic process Biological Process GO:0042742 defense response to bacterium Biological Process GO:0045493 xylan catabolic process Biological Process GO:0085030 symbiotic process benefiting host Biological Process GO:2000899 xyloglucan catabolic process Biological Process GO:0005764 lysosome Cellular Component GO:0008422 beta-glucosidase activity Molecular Function GO:0009044 xylan 1,4-beta-xylosidase activity Molecular Function GO:0015926 glucosidase activity Molecular Function GO:0046556 alpha-L-arabinofuranosidase activity Molecular Function |
| KEGG gene cross-reference | ddi:DDB_G0292810 ecj:JW2120 eco:b2132 ecoc:C3026_11955 stm:STM2166 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00933Glyco_hydro_349-377 aaPF01915Glyco_hydro_3_C414-622 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G529090 | PF00933 | Glyco_hydro_3 | 49 | 377 | 1.8e-71 | 241.9 |
| TkA02G529090 | PF01915 | Glyco_hydro_3_C | 414 | 622 | 5.6e-40 | 138.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.