TkA02G528050 | RubberDandelionOmics

Gene overview

TkA02G528050

Reference: TK1151 Chr: Chr02 Coordinates: 136173299-136179314 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2838 bp · TkA02G528050|TK1151|cDNA

GTTTTTCTTTCTAAAATCTTTGGTGTTTTTTAGGGTTTCTCGAGCTTTTTGTTACTTTTAATCTGTGATTTTCTTAGTTTCAGTCTATGGATTGTTCGGAAACTCGTTCAAATCGTAGAAATATGGAAGGTGGTGTCCTTGATCAGCCAAAAGAGGCGGGAAAATATTCCGCGGCCAAGAGCATCGTCATGGCCCCCCGCACTGTTGTGGGATTTGGGGACGGTACTGCTGCAGCGTTGAATGCCATTAGAACCGGTGAA...

CDS

Download CDS FASTA

2532 bp · TkA02G528050|TK1151|CDS

ATGAAAAGACCTGTGCATATATCACACTATTTGAGGTTTCAGTCTATGGATTGTTCGGAAACTCGTTCAAATCGTAGAAATATGGAAGGTGGTGTCCTTGATCAGCCAAAAGAGGCGGGAAAATATTCCGCGGCCAAGAGCATCGTCATGGCCCCCCGCACTGTTGTGGGATTTGGGGACGGTACTGCTGCAGCGTTGAATGCCATTAGAACCGGTGAAGGCGAGAAAAATAGTTTTGATAGCGGGAAAGCTTGTATCTC...

Protein

Download Protein FASTA

843 aa · TkA02G528050|TK1151|PROTEIN

MKRPVHISHYLRFQSMDCSETRSNRRNMEGGVLDQPKEAGKYSAAKSIVMAPRTVVGFGDGTAAALNAIRTGEGEKNSFDSGKACISKAPGENLSCNDLQLEYVKPVINNVNGSVIIPSDIVNRGSLQYSRTLYGYFIEEKEIDFSIVNSHFRNMWKIHGIEDIMMNDKGFYFFKFKSDEGMLDALEHGPWTMSNHNSPIFLKRWSPGLILDKSKHDKLKLPVWIRIYDMPLELWNKNGLNIIASMLGNPLAVDSCTARM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G528050`
TK1151 ID	TkA02G528050
OH-1004 ID	LXL04_012934
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.400
Protein coverage (%)	TK1151 97.746 / OH-1004 42.984 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G528050

Location Chr02:136173299-136179314 (-)

Description Similar to UBP12: Ubiquitin carboxyl-terminal hydrolase 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06600`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release
`At3g11910`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release
`At3g58250`	MATH domain and coiled-coil domain-containing protein At3g58250.	No verified direct reference in this release
`At3g58360`	MATH domain and coiled-coil domain-containing protein At3g58360.	No verified direct reference in this release
`At3g58210`	MATH domain and coiled-coil domain-containing protein At3g58210.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012934 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0070646 protein modification by small protein removal Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0004843 cysteine-type deubiquitinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G11910

ath:AT5G06600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.503

Rank 1 · TkA02G528050 · TK1151

Nucleus0.362

Rank 2 · TkA02G528050 · TK1151

Cell membrane0.138

Rank 3 · TkA02G528050 · TK1151

Endoplasmic reticulum0.072

Rank 4 · TkA02G528050 · TK1151

Mitochondrion0.056

Rank 5 · TkA02G528050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14111DUF4283130-210 aa

PF00917MATH350-417 aa

PF12436USP7_ICP0_bdg423-675 aa

PF22486MATH_2485-504 aa

PF22486MATH_2688-810 aa

PF00917MATH692-812 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G528050	`PF14111`	DUF4283	130	210	3.9e-12	46.4
TkA02G528050	`PF00917`	MATH	350	417	1.1e-16	61.8
TkA02G528050	`PF12436`	USP7_ICP0_bdg	423	675	6.1e-76	255.7
TkA02G528050	`PF22486`	MATH_2	485	504	7.6e-38	130.5
TkA02G528050	`PF22486`	MATH_2	688	810	7.6e-38	130.5
TkA02G528050	`PF00917`	MATH	692	812	1.1e-16	61.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FPT1`	Arabidopsis thaliana	sp\|Q9FPT1\|UBP12_ARATH Ubiquitin C-terminal hydrolase 12	70.100%	Swiss-Prot	Low
`Q84WU2`	Arabidopsis thaliana	sp\|Q84WU2\|UBP13_ARATH Ubiquitin C-terminal hydrolase 13	67.200%	Swiss-Prot	Low
`Q9M2J1`	Arabidopsis thaliana	sp\|Q9M2J1\|MCC19_ARATH MATH domain and coiled-coil domain-containing protein At3g58250	47.800%	Swiss-Prot	Low
`Q9M2I0`	Arabidopsis thaliana	sp\|Q9M2I0\|MCC25_ARATH MATH domain and coiled-coil domain-containing protein At3g58360	43.700%	Swiss-Prot	Low
`Q9M2J5`	Arabidopsis thaliana	sp\|Q9M2J5\|MCC16_ARATH MATH domain and coiled-coil domain-containing protein At3g58210	39.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card