TkA02G527540 | RubberDandelionOmics

Gene overview

TkA02G527540

Reference: TK1151 Chr: Chr02 Coordinates: 136044652-136047292 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1540 bp · TkA02G527540|TK1151|cDNA

GAATCTAGGTTTATCAGTACTGATGTAAACACCTTTAAATGAACCAACTTTGTAATGACATTAAATAACTTTATGGTTTACAGGGTTAAATTACAACCACAATCATGAATCGCCTCACGAGTTCTGCACGTCTCATGATTGTATCAGACCTTGACCAAACCATGGTTGATCATGATGACCCTGAAAACCTCTCTATGCTAAGGTTTAATGCCTTATGGGAAGCTAAATACCGCCATGATTCATTACTTGTATTCTCAACT...

CDS

Download CDS FASTA

1275 bp · TkA02G527540|TK1151|CDS

ATGAATCGCCTCACGAGTTCTGCACGTCTCATGATTGTATCAGACCTTGACCAAACCATGGTTGATCATGATGACCCTGAAAACCTCTCTATGCTAAGGTTTAATGCCTTATGGGAAGCTAAATACCGCCATGATTCATTACTTGTATTCTCAACTGGAAGATCACCTACAAGTTATAAACAATTGAGAAAAAGAAAACCCATGTTAACTCCAGATATTACCATTATGTCCATAGGAACCGAGATAACATACGGTAATGA...

Protein

Download Protein FASTA

424 aa · TkA02G527540|TK1151|PROTEIN

MNRLTSSARLMIVSDLDQTMVDHDDPENLSMLRFNALWEAKYRHDSLLVFSTGRSPTSYKQLRKRKPMLTPDITIMSIGTEITYGNEMVPDEDWFDFLNHKWDKKIVTEETSKFPELTLQSETEQRPHKASFKVKKEKAQEVMKNLYQVFVKRGLDVKIIYSSGMDLDVLPQGAGKGQALAYLHKKLKAEGKLPKNTLACGDSGNDADLFTIPDVHGVIVNNAQEELLEWYSENAKNNPKIIHADETCAAGIIQAIGHFK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G527540`
TK1151 ID	TkA02G527540
OH-1004 ID	LXL04_012941
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G527540

Location Chr02:136044652-136047292 (-)

Description Similar to SPP2: Sucrose-phosphatase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35840`	Catalyzes the final step of sucrose synthesis.	No verified direct reference in this release
`At1g51420`	Catalyzes the final step of sucrose synthesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0143100`	Catalyzes the final step of sucrose synthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012941 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005986 sucrose biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0050307 sucrose-phosphate phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT2G35840

dosa:Os01g0376700

dosa:Os02g0143100

nta:107767908

nta:107819363

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.575

Rank 1 · TkA02G527540 · TK1151

Nucleus0.276

Rank 2 · TkA02G527540 · TK1151

Mitochondrion0.132

Rank 3 · TkA02G527540 · TK1151

Cell membrane0.102

Rank 4 · TkA02G527540 · TK1151

Endoplasmic reticulum0.093

Rank 5 · TkA02G527540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05116S6PP9-260 aa

PF08282Hydrolase_312-85 aa

PF08282Hydrolase_388-231 aa

PF03206NifW88-152 aa

PF02358Trehalose_PPase91-136 aa

PF09848SLFN-g3_helicase92-162 aa

PF02358Trehalose_PPase138-211 aa

PF21141T6PP_C139-226 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G527540	`PF05116`	S6PP	9	260	2.7e-98	329.2
TkA02G527540	`PF08282`	Hydrolase_3	12	85	1.7e-14	54.9
TkA02G527540	`PF08282`	Hydrolase_3	88	231	1.7e-14	54.9
TkA02G527540	`PF03206`	NifW	88	152	0.24	12.6
TkA02G527540	`PF02358`	Trehalose_PPase	91	136	0.0061	16.4
TkA02G527540	`PF09848`	SLFN-g3_helicase	92	162	0.012	15.6
TkA02G527540	`PF02358`	Trehalose_PPase	138	211	0.0061	16.4
TkA02G527540	`PF21141`	T6PP_C	139	226	0.15	12.0
TkA02G527540	`PF08472`	S6PP_C	283	412	7.7e-49	165.6
TkA02G527540	`PF03206`	NifW	302	345	0.24	12.6
TkA02G527540	`PF02358`	Trehalose_PPase	390	412	0.0061	16.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJ66`	Arabidopsis thaliana	sp\|Q9SJ66\|SPP2_ARATH Probable sucrose-phosphatase 2	65.600%	Swiss-Prot	High
`Q9C8J4`	Arabidopsis thaliana	sp\|Q9C8J4\|SPP1_ARATH Probable sucrose-phosphatase 1	61.700%	Swiss-Prot	High
`Q6YXW6`	Oryza sativa subsp. japonica	sp\|Q6YXW6\|SPP2_ORYSJ Sucrose-phosphatase 2	61.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card