Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1218 bp · TkA02G524630|TK1151|cDNA
ATGGTTTCGGCCGGAGCTCCGCCGCTGTGTGTGGTTGCCGATTTTTTCTTCGGGTGGTCCGCGGCGGTAACCCACGAGTTCGGAATCTTCCATGTTATCTTCAGTGGATCCGGTGGGTTTGGATTAGCGTGTTACTTCTCTTCCTGGATCAATCTACCGCATAAAAACTCTGTTTCCGGCGAGTTCACTTTGCCAGATTTTCCAGAAGCCGGTAAAATGCAAGTGACCCAGTTAACTCCAAGCCTTGTAGTCGCCACCGG...
1218 bp · TkA02G524630|TK1151|CDS
ATGGTTTCGGCCGGAGCTCCGCCGCTGTGTGTGGTTGCCGATTTTTTCTTCGGGTGGTCCGCGGCGGTAACCCACGAGTTCGGAATCTTCCATGTTATCTTCAGTGGATCCGGTGGGTTTGGATTAGCGTGTTACTTCTCTTCCTGGATCAATCTACCGCATAAAAACTCTGTTTCCGGCGAGTTCACTTTGCCAGATTTTCCAGAAGCCGGTAAAATGCAAGTGACCCAGTTAACTCCAAGCCTTGTAGTCGCCACCGG...
Protein
Download Protein FASTA405 aa · TkA02G524630|TK1151|PROTEIN
MVSAGAPPLCVVADFFFGWSAAVTHEFGIFHVIFSGSGGFGLACYFSSWINLPHKNSVSGEFTLPDFPEAGKMQVTQLTPSLVVATGDDPWSKFQKQNLPAWQNSDGFLFNTIEELDKVGLSYFRRKFGLPVWAIGPINLSAHGGAQTGKNSRTETETCLQFLNSKPPSSVLYIFRIPKHHHSKPDDATCKSVRYKQEKLHLGSPAAAGMRHKHRVQSRGVAAGNFKKQIEEENRGLIVEKWAPQVEILSHESVGAFMSH...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G524630 |
|---|---|
| TK1151 ID | TkA02G524630 |
| OH-1004 ID | LXL04_012984 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 85.600 |
| Protein coverage (%) | TK1151 92.346 / OH-1004 77.002Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G524630 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:135287093-135288310 (+) | |||||||||
| Description | Similar to UGT92A1: UDP-glycosyltransferase 92A1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0009625 response to insect Biological Process GO:0016117 carotenoid biosynthetic process Biological Process GO:0051555 flavonol biosynthetic process Biological Process GO:0051707 response to other organism Biological Process GO:0009507 chloroplast Cellular Component GO:0035251 UDP-glucosyltransferase activity Molecular Function GO:0042802 identical protein binding Molecular Function GO:0047893 flavonol 3-O-glucosyltransferase activity Molecular Function GO:0050275 scopoletin glucosyltransferase activity Molecular Function GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G15480 ath:AT5G12890 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00201UDPGT238-326 aaPF04101Glyco_tran_28_C258-342 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G524630 | PF00201 | UDPGT | 238 | 326 | 3.7e-18 | 66.3 |
| TkA02G524630 | PF04101 | Glyco_tran_28_C | 258 | 342 | 0.035 | 14.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.