TkA02G522330 | RubberDandelionOmics

Gene overview

TkA02G522330

Reference: TK1151 Chr: Chr02 Coordinates: 134727049-134728375 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1231 bp · TkA02G522330|TK1151|cDNA

ATGATTACTGGTACTTCCCAGGCCGATTGCGCCGTTCTCATCATCGATTCCCCACTGGAGGTTTCGAAGCTGGTATTTCAAAGGATGGTCAGACCCGTGAGCACGCTCTTCTCGCCTTCACCCTTGGTATGGATGCTACCACCCCCAAATACTCCAAGTCCAGGTACGAGGAAATCGTGAAGGAAGTCTCTTCATACTTGAAGAAGGTCGGATACAACCCTGACAAAATCCCCTTCGTCCCAATCTCCGGATTCGAAGGT...

CDS

Download CDS FASTA

381 bp · TkA02G522330|TK1151|CDS

ATGGTCGTCACCTTCGGTCCCTCAGGGTTGACAACTGAAGTCAAGTCCGTCGTCGAGATGCACCACGAAGCATTGACTGAAGCTCTTCCCGGAGACAATGTCGGATTCAACGTCAAGAACGTTGCAGTCAAGGATCTCAAGCGTGGGTACGTCGCTTCGAACTCCAAGGACGACCCTGCTAAAGGTGCCGCCAGTTTCGTCTCCCAGGTTATCATTATGAACCACCCTGGACAGATCGGAACGGTTATGCTCCAGTCCTC...

Protein

Download Protein FASTA

126 aa · TkA02G522330|TK1151|PROTEIN

MVVTFGPSGLTTEVKSVVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFVSQVIIMNHPGQIGTVMLQSSIATPPTLLLSSKSVTKIDRRSGKEIEKEPKFLKNGDAGW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G522330`
TK1151 ID	TkA02G522330
OH-1004 ID	LXL04_013016
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	83.300
Protein coverage (%)	TK1151 99.206 / OH-1004 27.840 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G522330

Location Chr02:134727049-134728375 (+)

Description Similar to Elongation factor 1-alpha

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07940`	This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: O64937`	This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013016 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0006414 translational elongation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G07920

ath:AT1G07930

ath:AT1G07940

ath:AT5G60390

sly:101244084

sly:544055

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.331

Rank 1 · TkA02G522330 · TK1151

Nucleus0.226

Rank 2 · TkA02G522330 · TK1151

Mitochondrion0.203

Rank 3 · TkA02G522330 · TK1151

Plastid0.172

Rank 4 · TkA02G522330 · TK1151

Cell membrane0.115

Rank 5 · TkA02G522330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22594GTP-eEF1A_C2-23 aa

PF03144GTP_EFTU_D212-51 aa

PF22594GTP-eEF1A_C66-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G522330	`PF22594`	GTP-eEF1A_C	2	23	0.00043	21.4
TkA02G522330	`PF03144`	GTP_EFTU_D2	12	51	9.8e-07	29.8
TkA02G522330	`PF22594`	GTP-eEF1A_C	66	125	0.00043	21.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DH99`	Arabidopsis thaliana	sp\|P0DH99\|EF1A1_ARATH Elongation factor 1-alpha 1	78.600%	Swiss-Prot	High
`O64937`	Oryza sativa subsp. japonica	sp\|O64937\|EF1A_ORYSJ Elongation factor 1-alpha	80.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card