TkA02G520460 | RubberDandelionOmics

Gene overview

TkA02G520460

Reference: TK1151 Chr: Chr02 Coordinates: 134202144-134210300 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3213 bp · TkA02G520460|TK1151|cDNA

GTTTTGACTTGGTCAAAATCAGAAAGTTGGTCTCTTCTTTCTCACGTACGTCCCGACCGAGAGAAACAGAAAGAAGAATGAAAACAGGGAGAAACAAAAAATTGAGAGGAGATCGAGAGAGATTTTGTAGAGACGGTATGGAGAGACAGATATGAGACCGAGAGACAGAGACGGGACGGAGTAAAACAAGACAGACGACAAAGAGACAGCAGCGCTTGCTGCTGTCGGGTTTGGGTGAAGACTGAACCACCGCCAGCGGC...

CDS

Download CDS FASTA

1824 bp · TkA02G520460|TK1151|CDS

ATGACGTCTCATTCGAGCTCTTCATCATTCCCCGACAACGACGACGAACCCGCCGGCCCAAAACGTAATACCGACGATAATATCGGTTCAATTGATTACTCCCTGGACGCTATTGAAAACCAGTTGTCATCAATCGCATTGAAAACTTCAATTGACGGAGAAAGGCCATCGGTTGCTGATGATCATCACGAACTTCTGACGGAGACAGCCAAAGGATCTTCTAGAGAAATTGAAAGTGAGCGGCCGATAAATTCGACTGG...

Protein

Download Protein FASTA

607 aa · TkA02G520460|TK1151|PROTEIN

MTSHSSSSSFPDNDDEPAGPKRNTDDNIGSIDYSLDAIENQLSSIALKTSIDGERPSVADDHHELLTETAKGSSREIESERPINSTGESNLSTETGVWRNSSEVEVDGATSSPCSSGYAGEMGTSSGTASASGADDVQQHRNSSSSEGNNGEVLHSAQSQWVPGKRHVDEDDTCMSWRQRKKHFFVLSHSGKPIFSRYGNEHKLAGFSATLQAIISFVEDGGDRVHLVRAGKHQVVFLVKGPIYLVCISCTEEPYESLQG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G520460`
TK1151 ID	TkA02G520460
OH-1004 ID	LXL04_013044
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 96.540 / OH-1004 94.364 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G520460

Location Chr02:134202144-134210300 (-)

Description Similar to MON1: Vacuolar fusion protein MON1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28390`	Plays an important role in membrane trafficking through the secretory apparatus.	Activation of the Rab7 GTPase by the MON1-CCZ1 Complex Is Essential for PVC-to-Vacuole Trafficking and Plant Growth in Arabidopsis.2014 · DOI: 10.1105/tpc.114.123141

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0976000`	Plays an important role in membrane trafficking through the secretory apparatus.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013044 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006623 protein targeting to vacuole Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0007033 vacuole organization Biological Process

GO:0009306 protein secretion Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0045324 late endosome to vacuole transport Biological Process

GO:0099402 plant organ development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G28390

dosa:Os01g0976000

hsa:84315

mcf:102126726

mmu:72825

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.511

Rank 1 · TkA02G520460 · TK1151

Golgi apparatus0.294

Rank 2 · TkA02G520460 · TK1151

Lysosome / Vacuole0.234

Rank 3 · TkA02G520460 · TK1151

Nucleus0.200

Rank 4 · TkA02G520460 · TK1151

Cell membrane0.140

Rank 5 · TkA02G520460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19038Fuz_longin_3173-190 aa

PF19036Fuz_longin_1182-303 aa

PF19037Fuz_longin_2309-323 aa

PF19037Fuz_longin_2343-435 aa

PF19038Fuz_longin_3493-593 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G520460	`PF19038`	Fuz_longin_3	173	190	3.3e-24	86.2
TkA02G520460	`PF19036`	Fuz_longin_1	182	303	5e-30	105.0
TkA02G520460	`PF19037`	Fuz_longin_2	309	323	4.8e-23	81.9
TkA02G520460	`PF19037`	Fuz_longin_2	343	435	4.8e-23	81.9
TkA02G520460	`PF19038`	Fuz_longin_3	493	593	3.3e-24	86.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKN1`	Arabidopsis thaliana	sp\|Q9SKN1\|MON1_ARATH Vacuolar fusion protein MON1 homolog	69.000%	Swiss-Prot	High
`Q5JL08`	Oryza sativa subsp. japonica	sp\|Q5JL08\|MON1_ORYSJ Vacuolar fusion protein MON1 homolog	63.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card