Gene Card
Gene overview
cDNA / CDS / Protein Sequences
921 bp · TkA02G520260|TK1151|cDNA
GCCTTTATATGGGTAATTAGAAGTATTGCTAAAAGGCTAGGACTTGTAGAACAAAGGTTGGAATATTGCAAGAATTGGAGAAGAAAGGCTGTGCAGACCTGCGAACACGGGTCGTGTCATATGGACACGGGTCGTGTCACCCTTGGACACGGGTCGTGTCCCATGGACACGGGTCGTGTTCAGTGCCCAGCAGATTTTGAATACGACTGGATCCCATACGAATCATTACTCGAAAAAGCATACGCGAAACTTCACGGGTT...
921 bp · TkA02G520260|TK1151|CDS
GCCTTTATATGGGTAATTAGAAGTATTGCTAAAAGGCTAGGACTTGTAGAACAAAGGTTGGAATATTGCAAGAATTGGAGAAGAAAGGCTGTGCAGACCTGCGAACACGGGTCGTGTCATATGGACACGGGTCGTGTCACCCTTGGACACGGGTCGTGTCCCATGGACACGGGTCGTGTTCAGTGCCCAGCAGATTTTGAATACGACTGGATCCCATACGAATCATTACTCGAAAAAGCATACGCGAAACTTCACGGGTT...
Protein
Download Protein FASTA306 aa · TkA02G520260|TK1151|PROTEIN
AFIWVIRSIAKRLGLVEQRLEYCKNWRRKAVQTCEHGSCHMDTGRVTLGHGSCPMDTGRVQCPADFEYDWIPYESLLEKAYAKLHGFHETLEGGLVQDALVDLTGGAGEEIDMRSARVQIDLANRRLWSQLLRFKQGGFLLGAGNPSGSDVHISSSRIVQGHAYSLLQVREVDGHKFIQIRNQWANEVEWSEPWSDSSFEWTDTIKHKLKHVPRTKDEAFIWVIRSIAKRLGLVEQRLEYCKNWRRKAVQTCEHGSCHMD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G520260 |
|---|---|
| TK1151 ID | TkA02G520260 |
| OH-1004 ID | LXL04_010033 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.300 |
| Protein coverage (%) | TK1151 98.693 / OH-1004 29.695Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G520260 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:134160010-134165572 (+) | ||||||||||||
| Description | Similar to DEK1: Calpain-type cysteine protease DEK1 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0001558 regulation of cell growth Biological Process GO:0001708 cell fate specification Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0009934 regulation of meristem structural organization Biological Process GO:0032877 positive regulation of DNA endoreduplication Biological Process GO:0040014 regulation of multicellular organism growth Biological Process GO:0042127 regulation of cell population proliferation Biological Process GO:0090392 sepal giant cell differentiation Biological Process GO:0090628 plant epidermal cell fate specification Biological Process GO:0097264 self proteolysis Biological Process GO:2000011 regulation of adaxial/abaxial pattern formation Biological Process GO:2000014 regulation of endosperm development Biological Process | ||||||||||||
| KEGG gene cross-reference | ath:AT1G55350 dosa:Os02g0709400 osa:4330484 zma:542509 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00951Arteri_Gl1-36 aaPF24341OB_DEPS-1_6th2-11 aaPF05006PIF320-47 aaPF14169YdjO21-41 aaPF28388Vertnin_mid25-33 aaPF29726YkzT32-50 aaPF00355Rieske32-55 aaPF07936Defensin_438-58 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G520260 | PF00951 | Arteri_Gl | 1 | 36 | 0.11 | 13.1 |
| TkA02G520260 | PF24341 | OB_DEPS-1_6th | 2 | 11 | 0.16 | 12.3 |
| TkA02G520260 | PF05006 | PIF3 | 20 | 47 | 2.0 | 9.2 |
| TkA02G520260 | PF14169 | YdjO | 21 | 41 | 3.4 | 8.2 |
| TkA02G520260 | PF28388 | Vertnin_mid | 25 | 33 | 0.098 | 12.9 |
| TkA02G520260 | PF29726 | YkzT | 32 | 50 | 0.6 | 11.2 |
| TkA02G520260 | PF00355 | Rieske | 32 | 55 | 1.6 | 9.4 |
| TkA02G520260 | PF07936 | Defensin_4 | 38 | 58 | 4.8 | 7.9 |
| TkA02G520260 | PF26058 | DUF8019 | 45 | 66 | 0.047 | 14.5 |
| TkA02G520260 | PF24532 | FIBL-2 | 52 | 62 | 0.079 | 13.4 |
| TkA02G520260 | PF23548 | Zn_ribbon_FGT1_2 | 52 | 63 | 0.32 | 11.3 |
| TkA02G520260 | PF00648 | Peptidase_C2 | 74 | 222 | 8.9e-30 | 104.5 |
| TkA02G520260 | PF24341 | OB_DEPS-1_6th | 206 | 229 | 0.16 | 12.3 |
| TkA02G520260 | PF00951 | Arteri_Gl | 219 | 254 | 0.11 | 13.1 |
| TkA02G520260 | PF05006 | PIF3 | 238 | 266 | 2.0 | 9.2 |
| TkA02G520260 | PF14169 | YdjO | 239 | 259 | 3.4 | 8.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.