RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G520130
Reference: TK1151 Chr: Chr02 Coordinates: 134130308-134135295 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3624 bp · TkA02G520130|TK1151|cDNA

GGCTTGAGGCTACGCGCACCGGAAGCATATAATCCTGTCATTTTCGATTTCCGAGCAAACCAAAAAACAACTCCATCTCTCTCTTTCTCCTTTAGCCATCTCCCTCTCTCTTTCTCTCTTTCTCTAAAAATACTTCGTCTTCTTGGTCTCAACAACTGAACAAAATGTCTAGGGTTTCCCTCTCATTCCACCGTCACTCCTTCATTCCATCTCTCTAATGCTGCCTCTGTTGGCTCTCTTCTTCTTCACAGCAAGAACCC...

CDS

Download CDS FASTA

1782 bp · TkA02G520130|TK1151|CDS

ATGGCGATGGTTGCTCAACATCAACAGCACTTGGAGACGACAAGTAGCAGTAGCAGCATGAAACACCAATTAGATAACGGGAAATACGTAAGGTACACCGCGGAGCAAGTTGAAGCTCTAGAGAGAGTTTATTCAGAGTGCCCAAAGCCAAGTTCTTTAAGGAGGCAACAATTGATCAGAGAATGCCCTATTTTGTCCAACATAGAACCCAAACAAATCAAAGTTTGGTTTCAAAATCGCAGATGTCGGGAGAAGCAACG...

Protein

Download Protein FASTA

593 aa · TkA02G520130|TK1151|PROTEIN

MAMVAQHQQHLETTSSSSSMKHQLDNGKYVRYTAEQVEALERVYSECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLSAMNKLLMEENDRLQKQVSQLVYENGHMRQQLHTASAVTDASCESVVTTPQHSLRDANNPAGLLSIAEETLAEFLSKATGTAVDWVQMPGMKPGPDSVGIFAISQSCSGVAARACGLVSLEPTKIVEILKDRTSWYRDCRNVEVFTMLPAGNGGTIELVY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G520130
TK1151 IDTkA02G520130
OH-1004 IDLXL04_004496
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)89.300
Protein coverage (%)TK1151 99.663 / OH-1004 70.616
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G520130
LocationChr02:134130308-134135295 (-)
DescriptionSimilar to REV: Homeobox-leucine zipper protein REVOLUTA
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g60690 Probable transcription factor involved in the regulation of interfascicular fiber (cortical cells) and secondary xylem differentiation in the inflorescence stems.
IFL1, a gene regulating interfascicular fiber differentiation in Arabidopsis, encodes a homeodomain-leucine zipper protein.1999 · DOI: 10.1105/tpc.11.11.2139
Alteration of auxin polar transport in the Arabidopsis ifl1 mutants.2001 · DOI: 10.1104/pp.126.2.549
Amphivasal vascular bundle 1, a gain-of-function mutation of the IFL1/REV gene, is associated with alterations in the polarity of leaves, stems and carpels.2004 · DOI: 10.1093/pcp/pch051

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2Z8L4 Probable transcription factor. No verified direct reference in this release
Os10g0480200 Probable transcription factor. No verified direct reference in this release
Os03g0109400 Probable transcription factor. No verified direct reference in this release
UniProt: A2XBL9 Probable transcription factor. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_004496 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0009855 determination of bilateral symmetry Biological Process
GO:0009944 polarity specification of adaxial/abaxial axis Biological Process
GO:0009956 radial pattern formation Biological Process
GO:0010014 meristem initiation Biological Process
GO:0010051 xylem and phloem pattern formation Biological Process
GO:0010089 xylem development Biological Process
GO:0030154 cell differentiation Biological Process
GO:0005634 nucleus Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
GO:0003677 DNA binding Molecular Function
GO:0003700 DNA-binding transcription factor activity Molecular Function
KEGG gene cross-reference
ath:AT5G60690
dosa:Os03g0640800
dosa:Os10g0480200
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.759
Rank 1 · TkA02G520130 · TK1151
Cytoplasm0.251
Rank 2 · TkA02G520130 · TK1151
Cell membrane0.084
Rank 3 · TkA02G520130 · TK1151
Endoplasmic reticulum0.045
Rank 4 · TkA02G520130 · TK1151
Plastid0.024
Rank 5 · TkA02G520130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046Homeodomain28-86 aa
PF05920Homeobox_KN47-83 aa
PF30681ZPR72-133 aa
PF07765KIP176-119 aa
PF00170bZIP_180-122 aa
PF02183HALZ99-121 aa
PF01852START166-374 aa
PF25797PDF2_C316-325 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G520130PF00046Homeodomain28861.2e-1557.8
TkA02G520130PF05920Homeobox_KN47830.03914.5
TkA02G520130PF30681ZPR721330.005217.8
TkA02G520130PF07765KIP1761190.1413.0
TkA02G520130PF00170bZIP_1801220.0008220.1
TkA02G520130PF02183HALZ991210.212.5
TkA02G520130PF01852START1663743.8e-47161.0
TkA02G520130PF25797PDF2_C3163257.9e-0522.6
TkA02G520130PF25797PDF2_C3964757.9e-0522.6
TkA02G520130PF25797PDF2_C5755877.9e-0522.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SE43Arabidopsis thalianasp|Q9SE43|REV_ARATH Homeobox-leucine zipper protein REVOLUTA85.800%Swiss-ProtHigh
A2Z8L4Oryza sativa subsp. indicasp|A2Z8L4|HOX9_ORYSI Homeobox-leucine zipper protein HOX977.400%Swiss-ProtHigh
Q9AV49Oryza sativa subsp. japonicasp|Q9AV49|HOX9_ORYSJ Homeobox-leucine zipper protein HOX977.000%Swiss-ProtHigh
Q6TAQ6Oryza sativa subsp. japonicasp|Q6TAQ6|HOX10_ORYSJ Homeobox-leucine zipper protein HOX1076.400%Swiss-ProtHigh
A2XBL9Oryza sativa subsp. indicasp|A2XBL9|HOX10_ORYSI Homeobox-leucine zipper protein HOX1076.400%Swiss-ProtHigh

JBrowse

View in Genome Browser