TkA02G520070 | RubberDandelionOmics

Gene overview

TkA02G520070

Reference: TK1151 Chr: Chr02 Coordinates: 134101471-134105009 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3127 bp · TkA02G520070|TK1151|cDNA

TCGTATGTGCATTATTTCATCATAAATAAAATCAAATACGTAGTATATACACACATTTATCTTTAACATTAAAAAAAAGGAAGATACATATATAATTTCTTAACTCTTAATAATATAGATTAACCCAATGACCAAACAATGACATCATATCATCATGTACATCTTCTTAATTAATAACACAAACTTCAAATATTTCCAAAAAGAGTTGTCATTAAATTCCTCAAATTAATTAATTTGTAAAAAAGAATTCTGTTGGTTTT...

CDS

Download CDS FASTA

1959 bp · TkA02G520070|TK1151|CDS

ATGAACGAGGTTGAGAGAGGTGTAAACCCTCAACTCTGGCACGCTTGTGCTGGTGGGATGGTTCAAATGCCTCTACCTAATTCACACGTCTACTATTTCCCTCAAGGACATGCTGAACATACACTCACGACTGTAGATTTTGGCGGAATACCTAGGGTTCCTGCTTTCATTCTATGCAGGGTGATTGACGTCAAGTTTCTAGCAGACATGGAATCTGACGAAGTTTACGCCAAAATTAGGTTAAATCCTCTTGGAAACAC...

Protein

Download Protein FASTA

652 aa · TkA02G520070|TK1151|PROTEIN

MNEVERGVNPQLWHACAGGMVQMPLPNSHVYYFPQGHAEHTLTTVDFGGIPRVPAFILCRVIDVKFLADMESDEVYAKIRLNPLGNTDIGYNRGIDDGVLVETRNVHDSSDKPSSFSKTLTQSDANNGGGFSVPRYCAETIFPRLDYAADPPVQTVVAKDVHGDVWKFRHIYRGTPRRHLLTTGWSTFVNQKKLVAGDSIVFVRAENGDLCVGIRRAKRGGIGGPDSPSSWNSYSGNSSSSPSFYNGFSSFIRDNESKLM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G520070`
TK1151 ID	TkA02G520070
OH-1004 ID	LXL04_013049
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 92.614 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G520070

Location Chr02:134101471-134105009 (+)

Description Similar to ARF18: Auxin response factor 18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28350`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release
`At4g30080`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0685700`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release
`Os10g0479900`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release
`Os02g0628600`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013049 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007389 pattern specification process Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009743 response to carbohydrate Biological Process

GO:0010154 fruit development Biological Process

GO:0031540 regulation of anthocyanin biosynthetic process Biological Process

GO:0048366 leaf development Biological Process

GO:0048441 petal development Biological Process

GO:0048442 sepal development Biological Process

KEGG gene cross-reference

ath:AT2G28350

ath:AT4G30080

dosa:Os02g0628600

dosa:Os06g0685700

dosa:Os10g0479900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.970

Rank 1 · TkA02G520070 · TK1151

Cytoplasm0.078

Rank 2 · TkA02G520070 · TK1151

Cell membrane0.027

Rank 3 · TkA02G520070 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA02G520070 · TK1151

Plastid0.014

Rank 5 · TkA02G520070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25313BRWD_AD28-40 aa

PF02362B3116-217 aa

PF02362B3230-256 aa

PF25313BRWD_AD287-389 aa

PF06507ARF_AD306-389 aa

PF02309AUX_IAA532-573 aa

PF14326DUF4384574-634 aa

PF02309AUX_IAA584-613 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G520070	`PF25313`	BRWD_AD	28	40	2.9e-10	41.1
TkA02G520070	`PF02362`	B3	116	217	6.1e-24	84.6
TkA02G520070	`PF02362`	B3	230	256	6.1e-24	84.6
TkA02G520070	`PF25313`	BRWD_AD	287	389	2.9e-10	41.1
TkA02G520070	`PF06507`	ARF_AD	306	389	8.5e-34	116.0
TkA02G520070	`PF02309`	AUX_IAA	532	573	1.6e-05	25.5
TkA02G520070	`PF14326`	DUF4384	574	634	0.18	12.6
TkA02G520070	`PF02309`	AUX_IAA	584	613	1.6e-05	25.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKN5`	Arabidopsis thaliana	sp\|Q9SKN5\|ARFJ_ARATH Auxin response factor 10	53.900%	Swiss-Prot	High
`Q93YR9`	Arabidopsis thaliana	sp\|Q93YR9\|ARFP_ARATH Auxin response factor 16	52.400%	Swiss-Prot	High
`Q653H7`	Oryza sativa subsp. japonica	sp\|Q653H7\|ARFR_ORYSJ Auxin response factor 18	54.700%	Swiss-Prot	High
`Q9AV47`	Oryza sativa subsp. japonica	sp\|Q9AV47\|ARFV_ORYSJ Auxin response factor 22	55.500%	Swiss-Prot	High
`Q6K223`	Oryza sativa subsp. japonica	sp\|Q6K223\|ARFH_ORYSJ Auxin response factor 8	50.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card