TkA02G519680 | RubberDandelionOmics

Gene overview

TkA02G519680

Reference: TK1151 Chr: Chr02 Coordinates: 133972568-133975622 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1460 bp · TkA02G519680|TK1151|cDNA

GAAGCAAAGAAAGAAGAAATGCAATTTTAGGTGCCAACAGCCGATGGAGATGGCGGAAGACAAAATATAAACCCCTCCATTCCACATACATTGATTCAATTTCACACAACGCTTCCACTTTCTGGTTCATTTCCAGTCATCATCAACCGCCGTGATCCGCGATCACATCCTCTGCTAACCGCCGGTTGCTTTGTAAATCCACTCGCCGCATACATATTCCAAGTTTTATATCGTTTCAAACTTGCAGGAACTCCAAAGTC...

CDS

Download CDS FASTA

1038 bp · TkA02G519680|TK1151|CDS

ATGGGAGAATTGACGGGGTACCAGTTGGGGGTTATTGGTGCGTTGTTTCTATCTGTGGCATCATCAGTATCCATAGTTATCTGCAACAAAGCCCTCATGAGCAATCTCGGTTTTCCTTTTGCTACAACATTGACGAGTTGGCATCTGATGGTAACATACTGCACACTCCACGTGGCACATCGTTTGAATTTCTTCGAAAACAAAAGCATTGATATGAAGACTGTAATCCTATTTGGCATTCTAAACGGCGTTTCAATTGG...

Protein

Download Protein FASTA

345 aa · TkA02G519680|TK1151|PROTEIN

MGELTGYQLGVIGALFLSVASSVSIVICNKALMSNLGFPFATTLTSWHLMVTYCTLHVAHRLNFFENKSIDMKTVILFGILNGVSIGFLNLSLGFNSIGFYQMTKLAIIPFTVLLETLFLKKQFSQKIKLSLFLLLVGVGIASVTDLQLNFVGTILSLLAIMTTCVGQILTNTIQKRLNVTSTQLLYQSAPFQAAILFVTGPMVDQYLTNQYVFAFKYSPLVLGFIVLSCVIAVSVNFSTFLVIGKTSPVTYQVLGHLKT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G519680`
TK1151 ID	TkA02G519680
OH-1004 ID	LXL04_013054
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G519680

Location Chr02:133972568-133975622 (+)

Description Similar to UXT1: UDP-xylose transporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28315`	Nucleotide-sugar transporter that transports UDP-xylose and UMP in a strict counter-exchange mode.	Identification and Characterization of a Golgi-Localized UDP-Xylose Transporter Family from Arabidopsis.2015 · DOI: 10.1105/tpc.114.133827
`At2g30460`	Nucleotide-sugar transporter that transports UDP-xylose and UMP in a strict counter-exchange mode.	No verified direct reference in this release
`At1g06890`	Nucleotide-sugar transporter that transports UDP-xylose and UMP in a strict counter-exchange mode.	Identification and Characterization of a Golgi-Localized UDP-Xylose Transporter Family from Arabidopsis.2015 · DOI: 10.1105/tpc.114.133827
`At1g21070`	Nucleotide-sugar transporter that transports UDP-rhamnose or UDP-galactose and UMP in a strict counter-exchange mode.	No verified direct reference in this release
`At5g42420`	Nucleotide-sugar transporter that transports UDP-rhamnose or UDP-galactose and UMP in a strict counter-exchange mode.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013054 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0015790 UDP-xylose transmembrane transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:1900030 regulation of pectin biosynthetic process Biological Process

GO:1904659 D-glucose transmembrane transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G06890

ath:AT2G28315

ath:AT2G30460

ath:AT4G09810

ath:AT5G42420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.700

Rank 1 · TkA02G519680 · TK1151

Endoplasmic reticulum0.175

Rank 2 · TkA02G519680 · TK1151

Cytoplasm0.141

Rank 3 · TkA02G519680 · TK1151

Lysosome / Vacuole0.066

Rank 4 · TkA02G519680 · TK1151

Cell membrane0.053

Rank 5 · TkA02G519680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892EamA10-142 aa

PF03151TPT21-294 aa

PF03707MHYT27-27 aa

PF03707MHYT36-56 aa

PF27246MJ1433_N97-122 aa

PF27246MJ1433_N123-138 aa

PF03707MHYT146-167 aa

PF00892EamA155-197 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G519680	`PF00892`	EamA	10	142	5.7e-08	33.8
TkA02G519680	`PF03151`	TPT	21	294	3.2e-20	73.4
TkA02G519680	`PF03707`	MHYT	27	27	4.9	7.9
TkA02G519680	`PF03707`	MHYT	36	56	4.9	7.9
TkA02G519680	`PF27246`	MJ1433_N	97	122	3.8	8.5
TkA02G519680	`PF27246`	MJ1433_N	123	138	3.8	8.5
TkA02G519680	`PF03707`	MHYT	146	167	4.9	7.9
TkA02G519680	`PF00892`	EamA	155	197	5.7e-08	33.8
TkA02G519680	`PF00892`	EamA	220	293	5.7e-08	33.8
TkA02G519680	`PF22852`	SoxE_N	220	236	1.6	9.4
TkA02G519680	`PF27246`	MJ1433_N	221	232	3.8	8.5
TkA02G519680	`PF03707`	MHYT	224	254	4.9	7.9
TkA02G519680	`PF22852`	SoxE_N	280	295	1.6	9.4
TkA02G519680	`PF03707`	MHYT	283	293	4.9	7.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IHS9`	Arabidopsis thaliana	sp\|F4IHS9\|UXT1_ARATH UDP-xylose transporter 1	80.600%	Swiss-Prot	High
`Q8GUJ1`	Arabidopsis thaliana	sp\|Q8GUJ1\|UXT2_ARATH UDP-xylose transporter 2	68.800%	Swiss-Prot	High
`Q8RXL8`	Arabidopsis thaliana	sp\|Q8RXL8\|UXT3_ARATH UDP-xylose transporter 3	68.600%	Swiss-Prot	High
`Q9LPU2`	Arabidopsis thaliana	sp\|Q9LPU2\|URGT2_ARATH UDP-rhamnose/UDP-galactose transporter 2	37.300%	Swiss-Prot	Medium
`Q9FIH5`	Arabidopsis thaliana	sp\|Q9FIH5\|URGT3_ARATH UDP-rhamnose/UDP-galactose transporter 3	38.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card