RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G517290
Reference: TK1151 Chr: Chr02 Coordinates: 133324117-133325022 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

831 bp · TkA02G517290|TK1151|cDNA

ATGAACTTTATGCAAAAATCCACGGCGGCCACGAGCCGTGATCGAGCCCACCAAATCATCACAGGAAATCGTACGGAGTACCAGAGGCCTTGTTCCTCTTTTGGTGGTGGTAAAGGTAACAGTACGGCTCCTGGTTGTATGATCAGTTACTACAGAACTGATAGTTCACAGAAGCTGTCATCGGATGAAGAAGAAGATATGGCGAATTGCTTGATTATGTTAGCTCAGAGTCAGAGTGTTTCTCCGGCCAAGGAAGATAA...

CDS

Download CDS FASTA

831 bp · TkA02G517290|TK1151|CDS

ATGAACTTTATGCAAAAATCCACGGCGGCCACGAGCCGTGATCGAGCCCACCAAATCATCACAGGAAATCGTACGGAGTACCAGAGGCCTTGTTCCTCTTTTGGTGGTGGTAAAGGTAACAGTACGGCTCCTGGTTGTATGATCAGTTACTACAGAACTGATAGTTCACAGAAGCTGTCATCGGATGAAGAAGAAGATATGGCGAATTGCTTGATTATGTTAGCTCAGAGTCAGAGTGTTTCTCCGGCCAAGGAAGATAA...

Protein

Download Protein FASTA

276 aa · TkA02G517290|TK1151|PROTEIN

MNFMQKSTAATSRDRAHQIITGNRTEYQRPCSSFGGGKGNSTAPGCMISYYRTDSSQKLSSDEEEDMANCLIMLAQSQSVSPAKEDKSDRHSQKTEKLKNRTLTEIYECKTCNRAFPSFQALGGHRASHKKPKLNVEDRKSGSIKMEFSTVDQPEVVVEYEESKIISNGTKSPPPPGFIQTGQKNMKGKIHECSICGLEYLSGQALGGHMRRHRPLPPSNSQIANHSPHKSPMLSLDLNLPAPEFVDDVHSNFQYTASSP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G517290
TK1151 IDTkA02G517290
OH-1004 IDLXL04_013099
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)87.900
Protein coverage (%)TK1151 98.551 / OH-1004 95.498
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G517290
LocationChr02:133324117-133325022 (-)
DescriptionSimilar to ZAT5: Zinc finger protein ZAT5
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g28200 Probable transcription factor that may be involved in stress responses. No verified direct reference in this release
At3g60580 Probable transcription factor that may be involved in stress responses. No verified direct reference in this release
At3g19580 Transcriptional repressor involved in the inhibition of plant growth under abiotic stress conditions.
Functional identification of an Arabidopsis snf4 ortholog by screening for heterologous multicopy suppressors of snf4 deficiency in yeast.2000 · DOI: 10.1046/j.1365-313x.2000.00809.x
Arabidopsis Cys2/His2-type zinc-finger proteins function as transcription repressors under drought, cold, and high-salinity stress conditions.2004 · DOI: 10.1104/pp.104.046599
Mapping methyl jasmonate-mediated transcriptional reprogramming of metabolism and cell cycle progression in cultured Arabidopsis cells.2008 · DOI: 10.1073/pnas.0711203105
Arabidopsis zinc-finger protein 2 is a negative regulator of ABA signaling during seed germination.2010 · DOI: 10.1016/j.jplph.2010.05.010
Arabidopsis Cys2/His2 zinc-finger proteins AZF1 and AZF2 negatively regulate abscisic acid-repressive and auxin-inducible genes under abiotic stress conditions.2011 · DOI: 10.1104/pp.111.182683
Gene network analysis and functional studies of senescence-associated genes reveal novel regulators of Arabidopsis leaf senescence.2012 · DOI: 10.1111/j.1744-7909.2012.01136.x
At5g67450 Transcriptional repressor involved in the inhibition of plant growth under abiotic stress conditions.
Arabidopsis Cys2/His2-type zinc-finger proteins function as transcription repressors under drought, cold, and high-salinity stress conditions.2004 · DOI: 10.1104/pp.104.046599
Arabidopsis Cys2/His2 zinc-finger proteins AZF1 and AZF2 negatively regulate abscisic acid-repressive and auxin-inducible genes under abiotic stress conditions.2011 · DOI: 10.1104/pp.111.182683
At2g37430 Probable transcription factor that may be involved in stress responses. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_013099 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006950 response to stress Biological Process
GO:0006970 response to osmotic stress Biological Process
GO:0009409 response to cold Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009611 response to wounding Biological Process
GO:0009753 response to jasmonic acid Biological Process
GO:0010200 response to chitin Biological Process
GO:0010224 response to UV-B Biological Process
GO:0042631 cellular response to water deprivation Biological Process
GO:0071289 cellular response to nickel ion Biological Process
KEGG gene cross-reference
ath:AT2G28200
ath:AT2G37430
ath:AT2G45120
ath:AT3G53600
ath:AT3G60580
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.982
Rank 1 · TkA02G517290 · TK1151
Cytoplasm0.069
Rank 2 · TkA02G517290 · TK1151
Cell membrane0.022
Rank 3 · TkA02G517290 · TK1151
Endoplasmic reticulum0.013
Rank 4 · TkA02G517290 · TK1151
Plastid0.009
Rank 5 · TkA02G517290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14569zf-UDP29-66 aa
PF13878zf-C2H2_345-54 aa
PF12756zf-C2H2_2100-141 aa
PF30802zf-UBR_1104-113 aa
PF23475zf-Tbcl_FmdE104-118 aa
PF13878zf-C2H2_3105-113 aa
PF13465zf-H2C2_2106-116 aa
PF13912zf-C2H2_6107-132 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G517290PF14569zf-UDP29660.01815.8
TkA02G517290PF13878zf-C2H2_345540.06213.8
TkA02G517290PF12756zf-C2H2_21001410.009716.9
TkA02G517290PF30802zf-UBR_11041130.004218.1
TkA02G517290PF23475zf-Tbcl_FmdE1041180.04913.8
TkA02G517290PF13878zf-C2H2_31051130.06213.8
TkA02G517290PF13465zf-H2C2_21061160.6711.2
TkA02G517290PF13912zf-C2H2_61071323.5e-2484.9
TkA02G517290PF13894zf-C2H2_41071294.3e-0833.9
TkA02G517290PF00096zf-C2H21071290.0006920.7
TkA02G517290PF30802zf-UBR_11781980.004218.1
TkA02G517290PF13878zf-C2H2_31792050.06213.8
TkA02G517290PF14569zf-UDP1841970.01815.8
TkA02G517290PF23475zf-Tbcl_FmdE1861980.04913.8
TkA02G517290PF13465zf-H2C2_21891980.6711.2
TkA02G517290PF12756zf-C2H2_21902130.009716.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q681X4Arabidopsis thalianasp|Q681X4|ZAT5_ARATH Zinc finger protein ZAT540.600%Swiss-ProtMedium
Q9M202Arabidopsis thalianasp|Q9M202|ZAT9_ARATH Zinc finger protein ZAT932.300%Swiss-ProtMedium
Q9SSW2Arabidopsis thalianasp|Q9SSW2|AZF2_ARATH Zinc finger protein AZF233.000%Swiss-ProtMedium
Q9SSW1Arabidopsis thalianasp|Q9SSW1|AZF1_ARATH Zinc finger protein AZF133.300%Swiss-ProtMedium
Q9SLD4Arabidopsis thalianasp|Q9SLD4|ZAT11_ARATH Zinc finger protein ZAT1148.600%Swiss-ProtLow

JBrowse

View in Genome Browser