TkA02G513710 | RubberDandelionOmics

Gene overview

TkA02G513710

Reference: TK1151 Chr: Chr02 Coordinates: 131896104-131900180 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2332 bp · TkA02G513710|TK1151|cDNA

TAAATTTGCTAGTATATTTATATGGTAGGTGAGTTGAAACTGTAGGAAAATGACTAGGCAGTGAGAGGAGGTGGAAGCAGACAAGGAACTTCGCCATGGCGTTTTGAATGGAATAACACCACCGGTGGGCGGTGGTCCTTCCGGAAGCCTATTCACTGCCTGATTCCCTATTTCTAAGCTCGCCGCACCGACTCATACGCATTTTATTAAGCCCTAACCCAAACGCTAAACCCCCGTCAAAAACCCGCTTCCCTCTCTCT...

CDS

Download CDS FASTA

1665 bp · TkA02G513710|TK1151|CDS

ATGGAAACATCTACACACCTGTATGGTATCAAGACTTATTGTTTTCCAAAAAGCTCTCTGCATTCCCAATATTTGTGCTCAAAGCCAAGATCATTCGATTTTAATCCACACACTGAATCATGTACAACATTGAGAATTCCATCTCCAAGCAAAAAAAGAGGCGTGAGGGTTGTTTGTGATGCAAGAAAAAACGATGTTTTGGTACACAGTGAACCCAAAAGTCAAAATTTACAAGAATCAAGTAACCAACTATCATGTGT...

Protein

Download Protein FASTA

554 aa · TkA02G513710|TK1151|PROTEIN

METSTHLYGIKTYCFPKSSLHSQYLCSKPRSFDFNPHTESCTTLRIPSPSKKRGVRVVCDARKNDVLVHSEPKSQNLQESSNQLSCVMKFGGSSVASADRMKEIAELILSFPEENPVIVLSAMGKTTNNLIVAGEKAASCVSDVSEINELSFVKELHYKTVNELGLDKSLITDHLEKLERLLNSIAVLKELTPRARDYLVSFGECMSTRIFSGYLNKIGVKSRQYDAFDIGFITTDDFTNADILEATYPAVANKLHGDWN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G513710`
TK1151 ID	TkA02G513710
OH-1004 ID	LXL04_013170
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G513710

Location Chr02:131896104-131900180 (+)

Description Similar to AK3: Aspartokinase 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02020`	Involved in the first step of essential amino acids lysine, threonine, methionine and isoleucine synthesis via the aspartate-family pathway.	Identification of a monofunctional aspartate kinase gene of Arabidopsis thaliana with spatially and temporally regulated expression.2001 · DOI: 10.1266/ggs.76.189
`At5g14060`	Involved in the first step of essential amino acids lysine, threonine, methionine and isoleucine synthesis via the aspartate-family pathway.	No verified direct reference in this release
`At5g13280`	Involved in the first step of essential amino acids lysine, threonine, methionine and isoleucine synthesis via the aspartate-family pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013170 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006531 aspartate metabolic process Biological Process

GO:0008652 amino acid biosynthetic process Biological Process

GO:0009088 L-threonine biosynthetic process Biological Process

GO:0009089 L-lysine biosynthetic process via diaminopimelate Biological Process

GO:0009090 L-homoserine biosynthetic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004072 aspartate kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT3G02020

ath:AT5G13280

ath:AT5G14060

ecj:JW3984

eco:b4024

ecoc:C3026_21735

mja:MJ_0571

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.886

Rank 1 · TkA02G513710 · TK1151

Cytoplasm0.079

Rank 2 · TkA02G513710 · TK1151

Cell membrane0.057

Rank 3 · TkA02G513710 · TK1151

Mitochondrion0.050

Rank 4 · TkA02G513710 · TK1151

Peroxisome0.049

Rank 5 · TkA02G513710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00696AA_kinase86-366 aa

PF22380Chp1-like_SPOC162-215 aa

PF22380Chp1-like_SPOC379-419 aa

PF13840ACT_7394-439 aa

PF22468ACT_9402-445 aa

PF01842ACT403-468 aa

PF22468ACT_9479-538 aa

PF13840ACT_7479-536 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G513710	`PF00696`	AA_kinase	86	366	1.5e-45	156.5
TkA02G513710	`PF22380`	Chp1-like_SPOC	162	215	0.24	12.1
TkA02G513710	`PF22380`	Chp1-like_SPOC	379	419	0.24	12.1
TkA02G513710	`PF13840`	ACT_7	394	439	1.9e-07	31.5
TkA02G513710	`PF22468`	ACT_9	402	445	7.3e-25	87.2
TkA02G513710	`PF01842`	ACT	403	468	1.1e-08	35.4
TkA02G513710	`PF22468`	ACT_9	479	538	7.3e-25	87.2
TkA02G513710	`PF13840`	ACT_7	479	536	1.9e-07	31.5
TkA02G513710	`PF01842`	ACT	491	524	1.1e-08	35.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S702`	Arabidopsis thaliana	sp\|Q9S702\|AK3_ARATH Aspartokinase 3, chloroplastic	70.800%	Swiss-Prot	High
`O23653`	Arabidopsis thaliana	sp\|O23653\|AK2_ARATH Aspartokinase 2, chloroplastic	72.500%	Swiss-Prot	High
`Q9LYU8`	Arabidopsis thaliana	sp\|Q9LYU8\|AK1_ARATH Aspartokinase 1, chloroplastic	74.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card