TkA02G513470 | RubberDandelionOmics

Gene overview

TkA02G513470

Reference: TK1151 Chr: Chr02 Coordinates: 131826343-131829731 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2354 bp · TkA02G513470|TK1151|cDNA

ATAAGGAAAGCGTCATTTTATGAAACCTACAAAATGGTCAAGGTTCAACGCCGGAAGTACCGAGCCCAGTGCAACTTCCATTTTAGTTGAATTTGCGGAAGTTTCAATCACCTTCCCTGATTCCTAACGACAGAATTTCTAGACTGCGACAGCGATTGCGATCGATTTTTCTACCATTTCTCCTTCCTTTCGATGATTTTTCTGTTTTACCAAGCAAACGCGCTCGCAGACTTGCCGATTATTTCGCCGGAATCGATTAT...

CDS

Download CDS FASTA

1653 bp · TkA02G513470|TK1151|CDS

ATGAAGTCACTGGAGAAGTTTGGGCGCAAATTCACGATGCACAAGAACGATGGAAAGGAGAAGAGGGATCATCAGGCTTCCGCCCATCTGGATGAGCTTGTTCAGGCTTCCAAGGATATGCAAGACATTAGAAGCTCCTATGATGGCTTAATTGCTGCTGCTGCTGCAATGACAAATAGTATCTTCGAATTTTCAGAATCACTACATGAAATGGGGACCTGCTTGCTGGAGAAAACTACAAGTGATGTTGATGCTGAAAG...

Protein

Download Protein FASTA

550 aa · TkA02G513470|TK1151|PROTEIN

MKSLEKFGRKFTMHKNDGKEKRDHQASAHLDELVQASKDMQDIRSSYDGLIAAAAAMTNSIFEFSESLHEMGTCLLEKTTSDVDAESGRVLSTLGNIQAELQKIADSYRSYVIVTITNPSESLLSELRKVEEMKLQCDEKRGVYEYMMSQHKEKGKLRSEKKAETAVAKSLQEAQEEYNEAARLCAFRVKSLKEGQCRSLLTQATRHHAAQLNFFRKGFKALEAVDPVIKIVAEKHRIDCQLTGFDDVNGGGDDEGIDDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G513470`
TK1151 ID	TkA02G513470
OH-1004 ID	LXL04_013180
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G513470

Location Chr02:131826343-131829731 (+)

Description Similar to At2g33490: Uncharacterized protein At2g33490

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g33490`	Uncharacterized protein At2g33490.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013180 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G33490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.555

Rank 1 · TkA02G513470 · TK1151

Cell membrane0.325

Rank 2 · TkA02G513470 · TK1151

Nucleus0.207

Rank 3 · TkA02G513470 · TK1151

Golgi apparatus0.093

Rank 4 · TkA02G513470 · TK1151

Lysosome / Vacuole0.056

Rank 5 · TkA02G513470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06456Arfaptin12-108 aa

PF24235RHG29_45_N12-36 aa

PF16746BAR_328-234 aa

PF24235RHG29_45_N56-144 aa

PF06456Arfaptin324-356 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G513470	`PF06456`	Arfaptin	12	108	0.058	13.7
TkA02G513470	`PF24235`	RHG29_45_N	12	36	0.28	12.2
TkA02G513470	`PF16746`	BAR_3	28	234	1e-07	32.5
TkA02G513470	`PF24235`	RHG29_45_N	56	144	0.28	12.2
TkA02G513470	`PF06456`	Arfaptin	324	356	0.058	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22799`	Arabidopsis thaliana	sp\|O22799\|Y2349_ARATH Uncharacterized protein At2g33490	38.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card