TkA02G513410 | RubberDandelionOmics

Gene overview

TkA02G513410

Reference: TK1151 Chr: Chr02 Coordinates: 131804923-131807239 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1693 bp · TkA02G513410|TK1151|cDNA

CTCATATAGACGCTAGAATTCCGTCAATGGACAAACGGAATATGCGGTTTCATTAGCGAGAGGATAATGATATATAAAGCGGCAAGTTTCTTTGGAAATTGGAATATCCTGAGTACAAACCATAAACACATCCATCAAATTCAAAGGAAAAAGGGGAAGTTTCGGAAGCGTAGAGGAATATTCCGAGGGAGATCCGAAATTCCGATCTCGAGTTATTCCTCAATTCCTTGCTGATTCCTTCAGCATTTGCTTAAATACGC...

CDS

Download CDS FASTA

1134 bp · TkA02G513410|TK1151|CDS

ATGGCAACCAAGGCCGTTCATGTCTCCGACGTGCCAAATCTCGATCAAGTACCGGAAAATGCGGCCTCATTGTCTCTCTATGCCACAGCCACACGCCTCCCAATCAGTGTTGATGTGAGCAAAAATGGAAAAACCTCACCTAAATTTATGGTGATCGGTCATAGAGGTCACGGCATGAATATATTACACTCGGCAGATCGGAGAATGAAGGTCTTCAAGGAGAACTCTATTCTTTCCTTCAACAACGCTGCGAAGCATCC...

Protein

Download Protein FASTA

377 aa · TkA02G513410|TK1151|PROTEIN

MATKAVHVSDVPNLDQVPENAASLSLYATATRLPISVDVSKNGKTSPKFMVIGHRGHGMNILHSADRRMKVFKENSILSFNNAAKHPIDYIEFDVQVTKDDVAIIFHDNFILSEEHGALVEKRVTDLTVDEFFTYGPQREAGKEGKSLVRKVNGAVVGWLVESDDHSCTLQEAFEKVNPRLGFNIELKFDDNLIYEQANLTHILQVILKVVNEHAKDRPIIFSSFQPDAALIMKKLQQKYEVYFLTNGGTSLYDDVRRNS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G513410`
TK1151 ID	TkA02G513410
OH-1004 ID	LXL04_013182
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G513410

Location Chr02:131804923-131807239 (+)

Description Similar to GDPD1: Glycerophosphodiester phosphodiesterase GDPD1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02040`	Hydrolyzes glycerolphosphoglycerol, glycerophosphocholine and glycerophosphoethanolamine in vitro.	Characterization of the Arabidopsis glycerophosphodiester phosphodiesterase (GDPD) family reveals a role of the plastid-localized AtGDPD1 in maintaining cellular phosphate homeostasis under phosphate starvation.2011 · DOI: 10.1111/j.1365-313x.2011.04538.x
`At5g41080`	Glycerophosphodiester phosphodiesterase GDPD2.	No verified direct reference in this release
`At5g43300`	Glycerophosphodiester phosphodiesterase GDPD3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013182 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006071 glycerol metabolic process Biological Process

GO:0030643 intracellular phosphate ion homeostasis Biological Process

GO:0046475 glycerophospholipid catabolic process Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0008889 glycerophosphodiester phosphodiesterase activity Molecular Function

GO:0047389 glycerophosphocholine phosphodiesterase activity Molecular Function

GO:0047395 glycerophosphoinositol glycerophosphodiesterase activity Molecular Function

KEGG gene cross-reference

ago:AGOS_AGR223W

ath:AT3G02040

ath:AT5G41080

ath:AT5G43300

sce:YPL110C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.432

Rank 1 · TkA02G513410 · TK1151

Nucleus0.195

Rank 2 · TkA02G513410 · TK1151

Cell membrane0.171

Rank 3 · TkA02G513410 · TK1151

Endoplasmic reticulum0.126

Rank 4 · TkA02G513410 · TK1151

Mitochondrion0.086

Rank 5 · TkA02G513410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03009GDPD54-330 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G513410	`PF03009`	GDPD	54	330	2.3e-43	149.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGA2`	Arabidopsis thaliana	sp\|Q9SGA2\|GDPD1_ARATH Glycerophosphodiester phosphodiesterase GDPD1, chloroplastic	55.400%	Swiss-Prot	High
`Q9FLM1`	Arabidopsis thaliana	sp\|Q9FLM1\|GDPD2_ARATH Glycerophosphodiester phosphodiesterase GDPD2	55.100%	Swiss-Prot	High
`Q680A6`	Arabidopsis thaliana	sp\|Q680A6\|GDPD3_ARATH Glycerophosphodiester phosphodiesterase GDPD3	52.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card