TkA02G512050 | RubberDandelionOmics

Gene overview

TkA02G512050

Reference: TK1151 Chr: Chr02 Coordinates: 131433036-131433688 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

417 bp · TkA02G512050|TK1151|cDNA

GTGAAATGGCTAGTGAGGGTTCCTATATCGCTCATAGAGTTACTAATTTGGATTGTTTTAACATATTACACTATCGGTTTTGCTCCTTCAGCTAGTAGGTTTTTCCGACAGCTTTTGGCTTATATTGGCCTACATCAAATGGCTACATGTCTTTTTCGTTTCATTGCTGCCATTGGAAGAACACAGGTCATAGCAAATTCTCTTGGTACATTTTCGTTGCTATTGGTTTTTGTACTCGGTGGATTCATTGTGGCAAAAGA...

CDS

Download CDS FASTA

417 bp · TkA02G512050|TK1151|CDS

GTGAAATGGCTAGTGAGGGTTCCTATATCGCTCATAGAGTTACTAATTTGGATTGTTTTAACATATTACACTATCGGTTTTGCTCCTTCAGCTAGTAGGTTTTTCCGACAGCTTTTGGCTTATATTGGCCTACATCAAATGGCTACATGTCTTTTTCGTTTCATTGCTGCCATTGGAAGAACACAGGTCATAGCAAATTCTCTTGGTACATTTTCGTTGCTATTGGTTTTTGTACTCGGTGGATTCATTGTGGCAAAAGA...

Protein

Download Protein FASTA

138 aa · TkA02G512050|TK1151|PROTEIN

VKWLVRVPISLIELLIWIVLTYYTIGFAPSASRFFRQLLAYIGLHQMATCLFRFIAAIGRTQVIANSLGTFSLLLVFVLGGFIVAKDDIEPWMIWGYYISPMMYAQNAIAINEFLDDRWSTPNPDPRINETTVGFLSC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G512050`
TK1151 ID	TkA02G512050
OH-1004 ID	LXL04_022123
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	78.800
Protein coverage (%)	TK1151 95.652 / OH-1004 9.173 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G512050

Location Chr02:131433036-131433688 (-)

Description Similar to PDR2: Pleiotropic drug resistance protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g66950`	May be a general defense protein.	No verified direct reference in this release
`At2g36380`	May be a general defense protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0587600`	May be a general defense protein.	No verified direct reference in this release
`Os07g0522500`	ABC transporter modulating cadmium (Cd) import, thus controlling Cd²⁺ accumulation to prevent phytotoxicity.	Rice ABCG43 is Cd inducible and confers Cd tolerance on yeast.2011 · DOI: 10.1271/bbb.110193 Cadmium accumulation regulated by a rice heavy-metal importer is harmful for host plant and leaf bacteria.2023 · DOI: 10.1016/j.jare.2022.05.010

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022123 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009914 hormone transport Biological Process

GO:0015691 cadmium ion transport Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0042908 xenobiotic transport Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0098657 import into cell Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G66950

ath:AT2G36380

dosa:Os07g0522500

dosa:Os11g0587600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.563

Rank 1 · TkA02G512050 · TK1151

Endoplasmic reticulum0.193

Rank 2 · TkA02G512050 · TK1151

Lysosome / Vacuole0.144

Rank 3 · TkA02G512050 · TK1151

Cytoplasm0.065

Rank 4 · TkA02G512050 · TK1151

Golgi apparatus0.061

Rank 5 · TkA02G512050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01061ABC2_membrane2-114 aa

PF12698ABC2_membrane_32-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G512050	`PF01061`	ABC2_membrane	2	114	7.8e-29	101.4
TkA02G512050	`PF12698`	ABC2_membrane_3	2	109	0.0079	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7PC84`	Arabidopsis thaliana	sp\|Q7PC84\|AB39G_ARATH ABC transporter G family member 39	72.000%	Swiss-Prot	High
`Q7PC87`	Arabidopsis thaliana	sp\|Q7PC87\|AB34G_ARATH ABC transporter G family member 34	68.700%	Swiss-Prot	High
`Q8GU84`	Oryza sativa subsp. japonica	sp\|Q8GU84\|AB48G_ORYSJ ABC transporter G family member 48	58.800%	Swiss-Prot	High
`Q8GU86`	Oryza sativa subsp. japonica	sp\|Q8GU86\|AB43G_ORYSJ ABC transporter G family member 43	56.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card