TkA02G509030 | RubberDandelionOmics

Gene overview

TkA02G509030

Reference: TK1151 Chr: Chr02 Coordinates: 130654636-130656386 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1588 bp · TkA02G509030|TK1151|cDNA

CTTAACCCCAATCCGCCCTCAAATTACACATGGGTCTCCAATACCAAATTAATTGCGCCATTTATCACGGCACCATCGTTACTATTTAAACACCCCTATCACACTCATCCCTCTCACCCCACTTCCACCAAAAATGGCGACCACATTTCTGCCATTGATCCTCTTGCTCTCTTCACTCTCTCTTCTCATCATTGCTTCTTCTTCCTCACCCCAACAAACCTTCGAATCAGTCGTCCATGAAGTCAACCGGAGCATCAATA...

CDS

Download CDS FASTA

1218 bp · TkA02G509030|TK1151|CDS

ATGGCGACCACATTTCTGCCATTGATCCTCTTGCTCTCTTCACTCTCTCTTCTCATCATTGCTTCTTCTTCCTCACCCCAACAAACCTTCGAATCAGTCGTCCATGAAGTCAACCGGAGCATCAATAGCTCCCGGAGAAACTTGGGTTACCTCTCCTGCGGCACCGGCAACCCAGTCGACGACTGCTGGAGGTGTGACGCGAACTGGGCCAACAATCGTCAACGGCTAGCTGACTGTGCAATTGGGTTTGGAAAGGACGC...

Protein

Download Protein FASTA

405 aa · TkA02G509030|TK1151|PROTEIN

MATTFLPLILLLSSLSLLIIASSSSPQQTFESVVHEVNRSINSSRRNLGYLSCGTGNPVDDCWRCDANWANNRQRLADCAIGFGKDAIGGRNGRIYVVTDPHNDNPVNPVPGTLRYGVIQDEPLWIIFKRDMVIQLRQELVMNSFKTIDGRGVNVHIGNGPCITIHDATNIIIHGIHIHDCEQAGNGYIRNSPHHSGWWRQSDGDGITVESSKHIWIDHCSLSSCHDGLIDVIHGSTSITISNNYMTHHDKVMLLGHSDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G509030`
TK1151 ID	TkA02G509030
OH-1004 ID	LXL04_013255
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G509030

Location Chr02:130654636-130656386 (-)

Description Similar to Pectate lyase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27400`	Putative pectate lyase 11.	No verified direct reference in this release
`At4g24780`	Probable pectate lyase 18.	No verified direct reference in this release
`At5g63180`	Probable pectate lyase 22.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013255 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0030570 pectate lyase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G67750

ath:AT3G27400

ath:AT5G63180

sly:778293

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.370

Rank 1 · TkA02G509030 · TK1151

Lysosome / Vacuole0.350

Rank 2 · TkA02G509030 · TK1151

Cytoplasm0.135

Rank 3 · TkA02G509030 · TK1151

Endoplasmic reticulum0.114

Rank 4 · TkA02G509030 · TK1151

Cell membrane0.087

Rank 5 · TkA02G509030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15284PAGK4-33 aa

PF00544Pectate_lyase_4137-340 aa

PF13229Beta_helix162-246 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G509030	`PF15284`	PAGK	4	33	0.14	12.9
TkA02G509030	`PF00544`	Pectate_lyase_4	137	340	1.9e-24	87.0
TkA02G509030	`PF13229`	Beta_helix	162	246	0.00083	19.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTZ0`	Arabidopsis thaliana	sp\|Q9LTZ0\|PLY11_ARATH Putative pectate lyase 11	75.100%	Swiss-Prot	High
`Q9C5M8`	Arabidopsis thaliana	sp\|Q9C5M8\|PLY18_ARATH Probable pectate lyase 18	72.700%	Swiss-Prot	High
`Q93Z25`	Arabidopsis thaliana	sp\|Q93Z25\|PLY22_ARATH Probable pectate lyase 22	68.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card