TkA02G508660 | RubberDandelionOmics

Gene overview

TkA02G508660

Reference: TK1151 Chr: Chr02 Coordinates: 130546315-130547433 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1119 bp · TkA02G508660|TK1151|cDNA

ATGGCGATCAAGAAGCAGGCAAGAATGGAAGACAGACTCACTGCCTTACCCCACGACTTACAGCTTCATATTCTCACTTTCCTTGATACTAAAGACGCTTTCAAAACGTCTCTATTGTCAAAATCGTGGGCTTCTTTATGGAATAAGATCCCCCATCTGGAATTCAACTACTCTGTTTTCCTTAACCTCCATGTTTTCGATAAGTTCGTTAACAAGCTTTTGTCTGATCGTTATTCTGATCGATCAGCCAATTTGGACCG...

CDS

Download CDS FASTA

1119 bp · TkA02G508660|TK1151|CDS

ATGGCGATCAAGAAGCAGGCAAGAATGGAAGACAGACTCACTGCCTTACCCCACGACTTACAGCTTCATATTCTCACTTTCCTTGATACTAAAGACGCTTTCAAAACGTCTCTATTGTCAAAATCGTGGGCTTCTTTATGGAATAAGATCCCCCATCTGGAATTCAACTACTCTGTTTTCCTTAACCTCCATGTTTTCGATAAGTTCGTTAACAAGCTTTTGTCTGATCGTTATTCTGATCGATCAGCCAATTTGGACCG...

Protein

Download Protein FASTA

372 aa · TkA02G508660|TK1151|PROTEIN

MAIKKQARMEDRLTALPHDLQLHILTFLDTKDAFKTSLLSKSWASLWNKIPHLEFNYSVFLNLHVFDKFVNKLLSDRYSDRSANLDRLTFTRRGICSAKILNNVFGYAFSHGVKQLEAAIVNSRNHTWPDCNSPDANFESLTNLKLKSAVSMSCPFLWSRSGSFKNLTDLYLMRARIADRDPFSGFPMLEKLRLENCYFSEEIETLSIIARNLSDLTISSHRCFIGYFELTTPKLRFLEYQGYYFPQFKNHDGFPAVLDT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G508660`
TK1151 ID	TkA02G508660
OH-1004 ID	LXL04_024663
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	46.500
Protein coverage (%)	TK1151 99.462 / OH-1004 93.418 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G508660

Location Chr02:130546315-130547433 (+)

Description Similar to At4g03220: Putative F-box/FBD/LRR-repeat protein At4g03220

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55660`	F-box/LRR-repeat protein At1g55660.	No verified direct reference in this release
`At5g38390`	Putative F-box protein At5g38390.	No verified direct reference in this release
`At3g49030`	Putative F-box/FBD/LRR-repeat protein At3g49030.	No verified direct reference in this release
`At3g58940`	F-box/LRR-repeat protein At3g58940.	No verified direct reference in this release
`At4g00315`	Putative F-box/FBD/LRR-repeat protein At4g00315.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024663 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT2G04230

ath:AT3G18150

ath:AT3G26922

ath:AT4G03220

ath:AT5G22720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.838

Rank 1 · TkA02G508660 · TK1151

Cytoplasm0.207

Rank 2 · TkA02G508660 · TK1151

Cell membrane0.041

Rank 3 · TkA02G508660 · TK1151

Endoplasmic reticulum0.038

Rank 4 · TkA02G508660 · TK1151

Plastid0.016

Rank 5 · TkA02G508660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like14-47 aa

PF00646F-box15-50 aa

PF24758LRR_At5g56370111-221 aa

PF12799LRR_4138-145 aa

PF25019LRR_R13L1-DRL21139-197 aa

PF00646F-box141-154 aa

PF12799LRR_4165-206 aa

PF25019LRR_R13L1-DRL21234-250 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G508660	`PF12937`	F-box-like	14	47	3.1e-05	24.3
TkA02G508660	`PF00646`	F-box	15	50	2.3e-09	37.5
TkA02G508660	`PF24758`	LRR_At5g56370	111	221	0.0056	17.1
TkA02G508660	`PF12799`	LRR_4	138	145	0.0016	19.3
TkA02G508660	`PF25019`	LRR_R13L1-DRL21	139	197	0.029	15.0
TkA02G508660	`PF00646`	F-box	141	154	2.3e-09	37.5
TkA02G508660	`PF12799`	LRR_4	165	206	0.0016	19.3
TkA02G508660	`PF25019`	LRR_R13L1-DRL21	234	250	0.029	15.0
TkA02G508660	`PF12937`	F-box-like	286	305	3.1e-05	24.3
TkA02G508660	`PF12799`	LRR_4	303	325	0.0016	19.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PFK0`	Arabidopsis thaliana	sp\|Q1PFK0\|FBL32_ARATH F-box/LRR-repeat protein At1g55660	27.600%	Swiss-Prot	Low
`Q9FF23`	Arabidopsis thaliana	sp\|Q9FF23\|FB268_ARATH Putative F-box protein At5g38390	24.600%	Swiss-Prot	Low
`Q9SMU0`	Arabidopsis thaliana	sp\|Q9SMU0\|FDL18_ARATH Putative F-box/FBD/LRR-repeat protein At3g49030	27.300%	Swiss-Prot	Low
`Q9LXQ8`	Arabidopsis thaliana	sp\|Q9LXQ8\|FBL60_ARATH F-box/LRR-repeat protein At3g58940	28.000%	Swiss-Prot	Low
`Q3EAE5`	Arabidopsis thaliana	sp\|Q3EAE5\|FDL24_ARATH Putative F-box/FBD/LRR-repeat protein At4g00315	25.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card