RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G508390
Reference: TK1151 Chr: Chr02 Coordinates: 130490423-130492682 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1632 bp · TkA02G508390|TK1151|cDNA

CCTTTGTTCAAATCAAATTGCCACTTTTTGCTGTGCTTTTTCCCTGATTGATTCAATCAGCCATTCAGCCTCATATTAACTTCTCATCTAAAACCGATCATTTGAAATTTCTCTACATTCTCATATGAAACCTGGTGAACGGTGTCGTGAGGAGGGAATTGATGATCGGACGAGAGATGATGGCGAAGAAGAACGGCATGGGATTTTCATCGTCGTTTATGCTAGGGCCTCAGCCTGGTGAACGGTGTCGTGAAGATCCG...

CDS

Download CDS FASTA

312 bp · TkA02G508390|TK1151|CDS

ATGGGCTGCTGGTGTTGTTTGGAAGTTGGTTTGCTTGGTTTCGCTGCTGCCTTTGTGTTTTTTTGCTGGTCTTGGTGGTTGCTTGGCTTTCTGGACGATTTTGCCCTTCTTGGTTGGATGCTCTATGTGGCTGCTGCTGTTGGCTTTTTAATGGTGTCTTTTTGGAGCCGGTTTGTTTGGTTGGGCTGCTGTTCTGTGGTCATATGGGTCAGAGTGGTTTCGCTTGGTTTCTGGACGCTTTTGCCTTTTTGGGTTGGTTA...

Protein

Download Protein FASTA

103 aa · TkA02G508390|TK1151|PROTEIN

MGCWCCLEVGLLGFAAAFVFFCWSWWLLGFLDDFALLGWMLYVAAAVGFLMVSFWSRFVWLGCCSVVIWVRVVSLGFWTLLPFWVGYYLCMLLWVVVGSFCVC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G508390
TK1151 IDTkA02G508390
OH-1004 IDLXL04_009094
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)92.900
Protein coverage (%)TK1151 95.146 / OH-1004 21.304
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G508390
LocationChr02:130490423-130492682 (+)
DescriptionSimilar to HDG1: Homeobox-leucine zipper protein HDG1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_009094 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0009827 plant-type cell wall modification Biological Process
GO:0010143 cutin biosynthetic process Biological Process
GO:0030154 cell differentiation Biological Process
GO:0043481 anthocyanin accumulation in tissues in response to UV light Biological Process
GO:0048364 root development Biological Process
GO:0048497 maintenance of floral organ identity Biological Process
GO:0048765 root hair cell differentiation Biological Process
GO:0005634 nucleus Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function
GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference
ath:AT3G61150
ath:AT4G00730
dosa:Os04g0569100
dosa:Os08g0136100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.364
Rank 1 · TkA02G508390 · TK1151
Nucleus0.309
Rank 2 · TkA02G508390 · TK1151
Endoplasmic reticulum0.244
Rank 3 · TkA02G508390 · TK1151
Mitochondrion0.101
Rank 4 · TkA02G508390 · TK1151
Cell membrane0.092
Rank 5 · TkA02G508390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser