TkA02G507400 | RubberDandelionOmics

Gene overview

TkA02G507400

Reference: TK1151 Chr: Chr02 Coordinates: 130186236-130189410 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1725 bp · TkA02G507400|TK1151|cDNA

GTGGTCAGAGACGTCTACGATTCTATAAATCAGACTCGCAGTCCCAACATTTTCACATTCCATTATTGTCTTCTTGAGTTTGTCTTCATCCAAATTTCCAAGAGCACCAGTGTTGCGACGACGATGATGATGATGGCGATCGCGATGAAGCGCGCTGCTACTGCTGCAACTCGTGCTATCTCCTCTGCTAATTCCGGTTCGATTCTCACAAGACACCTCCATGCTTCTTCTGGCAAAAAGAAGATCGTAGGTGTTTCTAC...

CDS

Download CDS FASTA

396 bp · TkA02G507400|TK1151|CDS

ATGCGATATTATTGTTGTCAATACCCTTTAACTGAGAAAACAAAAGGAATGTTTGATAAAGAAAGGATTGGAAAATTGAAGAAAGGGGTTCTGATTGTTAACAATGCTAGAGGCGCTATCATGGATACACAAGCTGTTGTTGATGGATGTAATAGTGGACACATAGGAGGGTATAGTGGAGATGTTTGGTATCCTCAACCAGCTCCAAAAGATCATCCATGGAGATACATGCCAAATCAAGCAATGACCCCTCATATATC...

Protein

Download Protein FASTA

131 aa · TkA02G507400|TK1151|PROTEIN

MRYYCCQYPLTEKTKGMFDKERIGKLKKGVLIVNNARGAIMDTQAVVDGCNSGHIGGYSGDVWYPQPAPKDHPWRYMPNQAMTPHISGTTIDAQLRYAAGVKDMLENYFKGEEFPPQHYIVKEGELAPQYR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G507400`
TK1151 ID	TkA02G507400
OH-1004 ID	LXL04_013291
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 93.893 / OH-1004 31.378 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G507400

Location Chr02:130186236-130189410 (-)

Description Similar to FDH1: Formate dehydrogenase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14780`	Catalyzes the NAD(+)-dependent oxidation of formate to carbon dioxide.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0486800`	Catalyzes the NAD(+)-dependent oxidation of formate to carbon dioxide.	No verified direct reference in this release
`Os06g0486900`	Catalyzes the NAD(+)-dependent oxidation of formate to carbon dioxide.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013291 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0042183 formate catabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0008863 formate dehydrogenase (NAD+) activity Molecular Function

GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function

GO:0051287 NAD binding Molecular Function

KEGG gene cross-reference

ath:AT5G14780

dosa:Os06g0486900

sot:102577429

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.621

Rank 1 · TkA02G507400 · TK1151

Nucleus0.245

Rank 2 · TkA02G507400 · TK1151

Mitochondrion0.115

Rank 3 · TkA02G507400 · TK1151

Peroxisome0.090

Rank 4 · TkA02G507400 · TK1151

Extracellular0.075

Rank 5 · TkA02G507400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF028262-Hacid_dh_C6-87 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G507400	`PF02826`	2-Hacid_dh_C	6	87	5.7e-25	88.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7E4`	Arabidopsis thaliana	sp\|Q9S7E4\|FDH_ARATH Formate dehydrogenase, chloroplastic/mitochondrial	86.200%	Swiss-Prot	High
`Q9SXP2`	Oryza sativa subsp. japonica	sp\|Q9SXP2\|FDH1_ORYSJ Formate dehydrogenase 1, mitochondrial	82.100%	Swiss-Prot	High
`Q67U69`	Oryza sativa subsp. japonica	sp\|Q67U69\|FDH2_ORYSJ Formate dehydrogenase 2, mitochondrial	80.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card