TkA02G505820 | RubberDandelionOmics

Gene overview

TkA02G505820

Reference: TK1151 Chr: Chr02 Coordinates: 129770762-129771714 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

837 bp · TkA02G505820|TK1151|cDNA

ATGCTCTGCATCTCACTCTTTATCGCATCTTCACATTGTAAGCAACTTACCACCACGTTCTACCAGAAAACATGTCCCAGTTTTGAACGAATAATGCAGGAGACCACCACCAACAAACAGATCACCTCTCCCACCACCGCCGGCGCAGCTCTTCGCCTTTTTTTCCACGACTGCCTCGTGGAGGGCTGCGACGCCTCCGTCCTTATCTCCTCCACACCCTTCAACAAGGCCGAGCGCGACGCCGACATTAACCTTTCTCT...

CDS

Download CDS FASTA

837 bp · TkA02G505820|TK1151|CDS

ATGCTCTGCATCTCACTCTTTATCGCATCTTCACATTGTAAGCAACTTACCACCACGTTCTACCAGAAAACATGTCCCAGTTTTGAACGAATAATGCAGGAGACCACCACCAACAAACAGATCACCTCTCCCACCACCGCCGGCGCAGCTCTTCGCCTTTTTTTCCACGACTGCCTCGTGGAGGGCTGCGACGCCTCCGTCCTTATCTCCTCCACACCCTTCAACAAGGCCGAGCGCGACGCCGACATTAACCTTTCTCT...

Protein

Download Protein FASTA

278 aa · TkA02G505820|TK1151|PROTEIN

MLCISLFIASSHCKQLTTTFYQKTCPSFERIMQETTTNKQITSPTTAGAALRLFFHDCLVEGCDASVLISSTPFNKAERDADINLSLPGGPFYTVKLGRRDGLTSRATRAERILPKPTMSMNRIIKIFTSKGFSIQEMVALTGAHTIGFSHCSEIVSDIYNYSRVAESDPSFNPRYAAGLRNACADYRKNPSLSVFNDIMTPRDFDNSYYKNLPKGLGVLRSDRAMTMDARTRPFVELYARDQKQFFEAFGRAIEKLSLH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G505820`
TK1151 ID	TkA02G505820
OH-1004 ID	LXL04_024022
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	71.300
Protein coverage (%)	TK1151 100.000 / OH-1004 97.538 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G505820

Location Chr02:129770762-129771714 (+)

Description Similar to PER63: Peroxidase 63

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40150`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At3g28200`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At1g24110`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At5g47000`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At4g17690`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024022 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009044 xylan 1,4-beta-xylosidase activity Molecular Function

GO:0020037 heme binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0140825 lactoperoxidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G24110

ath:AT3G28200

ath:AT4G17690

ath:AT5G40150

ath:AT5G47000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.694

Rank 1 · TkA02G505820 · TK1151

Cytoplasm0.069

Rank 2 · TkA02G505820 · TK1151

Lysosome / Vacuole0.053

Rank 3 · TkA02G505820 · TK1151

Cell membrane0.028

Rank 4 · TkA02G505820 · TK1151

Endoplasmic reticulum0.027

Rank 5 · TkA02G505820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00141peroxidase37-87 aa

PF00141peroxidase87-242 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G505820	`PF00141`	peroxidase	37	87	1.3e-54	186.2
TkA02G505820	`PF00141`	peroxidase	87	242	1.3e-54	186.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL16`	Arabidopsis thaliana	sp\|Q9FL16\|PER63_ARATH Peroxidase 63	50.500%	Swiss-Prot	High
`Q9LHA7`	Arabidopsis thaliana	sp\|Q9LHA7\|PER31_ARATH Peroxidase 31	51.100%	Swiss-Prot	High
`O48677`	Arabidopsis thaliana	sp\|O48677\|PER6_ARATH Peroxidase 6	47.000%	Swiss-Prot	Medium
`Q9FJR1`	Arabidopsis thaliana	sp\|Q9FJR1\|PER65_ARATH Peroxidase 65	45.500%	Swiss-Prot	Medium
`O23609`	Arabidopsis thaliana	sp\|O23609\|PER41_ARATH Peroxidase 41	46.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card