TkA02G505210 | RubberDandelionOmics

Gene overview

TkA02G505210

Reference: TK1151 Chr: Chr02 Coordinates: 129604249-129607045 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

917 bp · TkA02G505210|TK1151|cDNA

CACAATACAAAAATTTCTTCACCTCTTTTCTGTTTCTACCGCTTATTTCATCTTCTCCAACCTCGTTTGTTTTTGCTAAACAAGTAATCATTCTCAAAAACTTCGATCCAAAGGTGATTCAACTTGTTCCATTTTCTTGGGTGCTTAGATCTGCCCCAATTTTTTCCCTCAAGGTTACTTCACAGCCGAAGTTGTTATCTGCAGGATGAAACGAATACGAGATGATGGTTATGGTAGCTCTCAATTTAAGAGGCCATTTG...

CDS

Download CDS FASTA

696 bp · TkA02G505210|TK1151|CDS

ATGATGGTTATGGTAGCTCTCAATTTAAGAGGCCATTTGGTTCTTCCCGAGGAGAATCATATGGCCAACCACAAGCCCCGGAGGAGGAGGGAGGAGGAAGGAGTAGGAGGGGCGGCGGCGGCAGGTGCTAGTGTAGAAGGCGGTGGTGGTGGTGGTGGGGGAGGTGCCAGCAGTGCACAAAAACTCACAACCAATGATGCATTGACTTATTTAAAGGAGGTCAAAGATATGTTCCAAAACCAAAGAGAGAAATATGACCA...

Protein

Download Protein FASTA

231 aa · TkA02G505210|TK1151|PROTEIN

MMVMVALNLRGHLVLPEENHMANHKPRRRREEEGVGGAAAAGASVEGGGGGGGGGASSAQKLTTNDALTYLKEVKDMFQNQREKYDQFLDVMKDFKAQRIDTTGVIARVKDLFKGHNNLIFGFNTFLPKGYEISSAPYDDKDALKSIYSQEFTFCENVKSRLRNPDDYQAFLKCLHIYSTEIITRKELQSLVADLLGKHADLMEGFSAFLERCENIGAFYLLNYIIAVLKF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G505210`
TK1151 ID	TkA02G505210
OH-1004 ID	LXL04_013325
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	74.100
Protein coverage (%)	TK1151 68.398 / OH-1004 80.612 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G505210

Location Chr02:129604249-129607045 (+)

Description Similar to SNL2: Paired amphipathic helix protein Sin3-like 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01320`	Acts as a transcriptional repressor.	PAH-domain-specific interactions of the Arabidopsis transcription coregulator SIN3-LIKE1 (SNL1) with telomere-binding protein 1 and ALWAYS EARLY2 Myb-DNA binding factors.2010 · DOI: 10.1016/j.jmb.2009.11.065
`At5g15020`	Acts as a transcriptional repressor.	No verified direct reference in this release
`At1g70060`	Acts as a transcriptional repressor.	No verified direct reference in this release
`At1g24190`	Acts as a transcriptional repressor.	Role of an Arabidopsis AP2/EREBP-type transcriptional repressor in abscisic acid and drought stress responses.2005 · DOI: 10.1105/tpc.105.033043
`At1g59890`	Acts as a transcriptional repressor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013325 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0000118 histone deacetylase complex Cellular Component

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0070822 Sin3-type complex Cellular Component

GO:0003714 transcription corepressor activity Molecular Function

KEGG gene cross-reference

ath:AT1G70060

ath:AT3G01320

ath:AT5G15020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.443

Rank 1 · TkA02G505210 · TK1151

Cytoplasm0.437

Rank 2 · TkA02G505210 · TK1151

Cell membrane0.155

Rank 3 · TkA02G505210 · TK1151

Endoplasmic reticulum0.072

Rank 4 · TkA02G505210 · TK1151

Golgi apparatus0.051

Rank 5 · TkA02G505210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07941K_channel_TID38-64 aa

PF23116HHD_RTEL167-128 aa

PF23202PAH_ZNF59871-115 aa

PF02671PAH72-80 aa

PF25972At4g15545_C81-124 aa

PF02671PAH83-127 aa

PF07941K_channel_TID122-132 aa

PF23116HHD_RTEL1150-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G505210	`PF07941`	K_channel_TID	38	64	0.067	14.4
TkA02G505210	`PF23116`	HHD_RTEL1	67	128	5.7e-07	30.8
TkA02G505210	`PF23202`	PAH_ZNF598	71	115	3.6e-09	37.5
TkA02G505210	`PF02671`	PAH	72	80	3.5e-36	123.4
TkA02G505210	`PF25972`	At4g15545_C	81	124	0.00019	22.1
TkA02G505210	`PF02671`	PAH	83	127	3.5e-36	123.4
TkA02G505210	`PF07941`	K_channel_TID	122	132	0.067	14.4
TkA02G505210	`PF23116`	HHD_RTEL1	150	210	5.7e-07	30.8
TkA02G505210	`PF23202`	PAH_ZNF598	154	216	3.6e-09	37.5
TkA02G505210	`PF25972`	At4g15545_C	154	212	0.00019	22.1
TkA02G505210	`PF02671`	PAH	167	210	3.5e-36	123.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRH9`	Arabidopsis thaliana	sp\|Q9SRH9\|SNL1_ARATH Paired amphipathic helix protein Sin3-like 1	57.100%	Swiss-Prot	Medium
`Q9LFQ3`	Arabidopsis thaliana	sp\|Q9LFQ3\|SNL2_ARATH Paired amphipathic helix protein Sin3-like 2	52.600%	Swiss-Prot	Medium
`O04539`	Arabidopsis thaliana	sp\|O04539\|SNL4_ARATH Paired amphipathic helix protein Sin3-like 4	53.800%	Swiss-Prot	Medium
`O48686`	Arabidopsis thaliana	sp\|O48686\|SNL3_ARATH Paired amphipathic helix protein Sin3-like 3	52.300%	Swiss-Prot	Medium
`Q9XIE1`	Arabidopsis thaliana	sp\|Q9XIE1\|SNL5_ARATH Paired amphipathic helix protein Sin3-like 5	52.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card