Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2304 bp · TkA02G503700|TK1151|cDNA
GTTTTAGAAGGCGAGGCAACACGCGATTCCCATGGGGCTCTTGTGCATTTGATATTCTCTCACCTTCTTTCCTCTTTCGCGCCATTAACCCGTTACTCCTCTTTGCTCTTCATCTTTATTAAGCCATTACTACTCGATCAAAACCCTAGCATCTTATCTGTAACTATGGCGGACGGTCACATGTTCAATAACATCTCTCTTGTTGGCCGTGGCGGCACTAATCCAGGTCAACTTAGGGTTCATTCACGTGGCCTGCAATG...
2103 bp · TkA02G503700|TK1151|CDS
GTTTTAGAAGGCGAGGCAACACGCGATTCCCATGGGGCTCTTGTGCATTTGATATTCTCTCACCTTCTTTCCTCTTTCGCGCCATTAACCCGTTACTCCTCTTTGCTCTTCATCTTTATTAAGCCATTACTACTCGATCAAAACCCTAGCATCTTATCTGTAACTATGGCGGACGGTCACATGTTCAATAACATCTCTCTTGTTGGCCGTGGCGGCACTAATCCAGGTCAACTTAGGGTTCATTCACGTGGCCTGCAATG...
Protein
Download Protein FASTA700 aa · TkA02G503700|TK1151|PROTEIN
VLEGEATRDSHGALVHLIFSHLLSSFAPLTRYSSLLFIFIKPLLLDQNPSILSVTMADGHMFNNISLVGRGGTNPGQLRVHSRGLQWKKQGGGKAVEVDKSDIVRITWMKVPRSNQLGVQIKDGLKYKFTGFRDQDVSSLTNFFQNSCGITPEEKQLSVSGKNWGELDINGNMLSFLVGSKQAFEISLADVSQTQLQGKNDVLLEFHVDDTTGANEKDSLMEMSFHIPSSNTQFVGDENHPPAQIFRDKIMSMADVGAGG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G503700 |
|---|---|
| TK1151 ID | TkA02G503700 |
| OH-1004 ID | LXL04_010406 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 89.000 |
| Protein coverage (%) | TK1151 89.857 / OH-1004 98.140Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G503700 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:129185069-129189578 (+) | ||||||||||||
| Description | Similar to SSRP1: FACT complex subunit SSRP1 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000741 karyogamy Biological Process GO:0006260 DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0010197 polar nucleus fusion Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0048731 system development Biological Process GO:0000791 euchromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0035101 FACT complex Cellular Component GO:0003677 DNA binding Molecular Function GO:0003700 DNA-binding transcription factor activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT3G28730 dosa:Os01g0184900 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08512Rttp106-like_middle33-57 aaPF17292POB3_N61-153 aaPF03531SSrecog72-106 aaPF08512Rttp106-like_middle113-146 aaPF03531SSrecog157-244 aaPF17292POB3_N162-195 aaPF21103PH1_SSRP1-like262-390 aaPF17292POB3_N379-488 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G503700 | PF08512 | Rttp106-like_middle | 33 | 57 | 3.2e-24 | 85.8 |
| TkA02G503700 | PF17292 | POB3_N | 61 | 153 | 9.9e-28 | 97.2 |
| TkA02G503700 | PF03531 | SSrecog | 72 | 106 | 5.4e-28 | 97.5 |
| TkA02G503700 | PF08512 | Rttp106-like_middle | 113 | 146 | 3.2e-24 | 85.8 |
| TkA02G503700 | PF03531 | SSrecog | 157 | 244 | 5.4e-28 | 97.5 |
| TkA02G503700 | PF17292 | POB3_N | 162 | 195 | 9.9e-28 | 97.2 |
| TkA02G503700 | PF21103 | PH1_SSRP1-like | 262 | 390 | 7.1e-50 | 169.0 |
| TkA02G503700 | PF17292 | POB3_N | 379 | 488 | 9.9e-28 | 97.2 |
| TkA02G503700 | PF08512 | Rttp106-like_middle | 404 | 495 | 3.2e-24 | 85.8 |
| TkA02G503700 | PF02724 | CDC45 | 510 | 614 | 0.04 | 12.9 |
| TkA02G503700 | PF05764 | YL1 | 510 | 611 | 0.079 | 13.8 |
| TkA02G503700 | PF09011 | HMG_box_2 | 613 | 681 | 2.5e-14 | 54.4 |
| TkA02G503700 | PF00505 | HMG_box | 616 | 684 | 7.1e-20 | 71.9 |
| TkA02G503700 | PF24815 | HMG_WDHD1 | 621 | 666 | 0.12 | 13.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.