TkA02G501530 | RubberDandelionOmics

Gene overview

TkA02G501530

Reference: TK1151 Chr: Chr02 Coordinates: 128503196-128505315 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1595 bp · TkA02G501530|TK1151|cDNA

AAGCATTGTGTGCACCAGTCCAAGAGCCAACGGCTCTTTCTTCCCTTTTTCTTTATTAATTTTTTGCCTATGAAAATTCACCCCCACAGCGTATGTGGCGCCTACGTGGCAGCTTTTTTGCCTGTGAAAACCCCACACCCTCTAGTCAGCATCCTCACTTTCCCTTTCGTGTCACTTTGCCCTCATTCTGCAGTTCCCATGGCTTTGTTTTCAACTATTCACTTCATCATCGGCGTCGCCCTTCTCGTAAATACAGTTCA...

CDS

Download CDS FASTA

945 bp · TkA02G501530|TK1151|CDS

ATGAAAATTCACCCCCACAGCGTATGTGGCGCCTACGTGGCAGCTTTTTTGCCTGTGAAAACCCCACACCCTCTAGTCAGCATCCTCACTTTCCCTTTCGTGTCACTTTGCCCTCATTCTGCAGTTCCCATGGCTTTGTTTTCAACTATTCACTTCATCATCGGCGTCGCCCTTCTCGTAAATACAGTTCAAGGAATTGGCAGCGAGATCGTCTTCGAGGAAGGTTACACTGTCTCTACAGTCCTCGACGGTGACAAGCT...

Protein

Download Protein FASTA

314 aa · TkA02G501530|TK1151|PROTEIN

MKIHPHSVCGAYVAAFLPVKTPHPLVSILTFPFVSLCPHSAVPMALFSTIHFIIGVALLVNTVQGIGSEIVFEEGYTVSTVLDGDKLHINPNSVFSLYGSSSDLIVLDSVKSTFYTVSFSDSQVSKIKEVSGHGVAGYKDGDLMSAMFNKPKSFAVDRKNNIYIADKTNHVIRKISTSGVTTIAGGYLQKTGKVDGPAQNASFSADFELAFDPQRCALLISDHGNRLVRQLDLKPNDCTSSSSGSGLGSTTAWCIGMVVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G501530`
TK1151 ID	TkA02G501530
OH-1004 ID	LXL04_006162
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	44.300
Protein coverage (%)	TK1151 55.096 / OH-1004 35.081 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G501530`
Location	Chr02:128503196-128505315 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006162` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.414

Rank 1 · TkA02G501530 · TK1151

Lysosome / Vacuole0.281

Rank 2 · TkA02G501530 · TK1151

Cytoplasm0.169

Rank 3 · TkA02G501530 · TK1151

Endoplasmic reticulum0.137

Rank 4 · TkA02G501530 · TK1151

Golgi apparatus0.103

Rank 5 · TkA02G501530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18956DUF569945-62 aa

PF01436NHL103-109 aa

PF25021TEN_NHL109-134 aa

PF10267Tmemb_cc2125-178 aa

PF25021TEN_NHL143-183 aa

PF01436NHL148-173 aa

PF06739SBBP151-170 aa

PF25021TEN_NHL196-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G501530	`PF18956`	DUF5699	45	62	1.5	9.7
TkA02G501530	`PF01436`	NHL	103	109	0.0004	21.0
TkA02G501530	`PF25021`	TEN_NHL	109	134	0.00099	18.9
TkA02G501530	`PF10267`	Tmemb_cc2	125	178	0.42	10.5
TkA02G501530	`PF25021`	TEN_NHL	143	183	0.00099	18.9
TkA02G501530	`PF01436`	NHL	148	173	0.0004	21.0
TkA02G501530	`PF06739`	SBBP	151	170	0.022	15.4
TkA02G501530	`PF25021`	TEN_NHL	196	231	0.00099	18.9
TkA02G501530	`PF01436`	NHL	218	227	0.0004	21.0
TkA02G501530	`PF18956`	DUF5699	257	280	1.5	9.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card