TkA02G501240 | RubberDandelionOmics

Gene overview

TkA02G501240

Reference: TK1151 Chr: Chr02 Coordinates: 128425729-128426103 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

375 bp · TkA02G501240|TK1151|cDNA

ATGATCAAAAGACTGCAAGACACCCAACATTCCGAAAAACAATTCGCATCGGAAATGTCAACCCTCGGAAAAGTCAAACACCGAAACCTCGTCCCCCTCTTAGGGTTTTGTCTCGCAAAAAAAGAACGTCTGTTAGTCTACAAATACATGCCAAACGGCAACCTCCACGACAAACTCCACCTCTCAGAATACTCCACAAAACCCCTCGACTGGCCTTCAAGGCTAAGAATTGGGATCGGTATAGCCAAAGGATTAGCCTG...

CDS

Download CDS FASTA

375 bp · TkA02G501240|TK1151|CDS

ATGATCAAAAGACTGCAAGACACCCAACATTCCGAAAAACAATTCGCATCGGAAATGTCAACCCTCGGAAAAGTCAAACACCGAAACCTCGTCCCCCTCTTAGGGTTTTGTCTCGCAAAAAAAGAACGTCTGTTAGTCTACAAATACATGCCAAACGGCAACCTCCACGACAAACTCCACCTCTCAGAATACTCCACAAAACCCCTCGACTGGCCTTCAAGGCTAAGAATTGGGATCGGTATAGCCAAAGGATTAGCCTG...

Protein

Download Protein FASTA

124 aa · TkA02G501240|TK1151|PROTEIN

MIKRLQDTQHSEKQFASEMSTLGKVKHRNLVPLLGFCLAKKERLLVYKYMPNGNLHDKLHLSEYSTKPLDWPSRLRIGIGIAKGLAWLHHNCNPRILHRNISSRCILLDSDLEPRISDLGSPGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G501240`
TK1151 ID	TkA02G501240
OH-1004 ID	LXL04_036691
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.300
Protein coverage (%)	TK1151 96.774 / OH-1004 19.608 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G501240

Location Chr02:128425729-128426103 (+)

Description Similar to At5g48380: Probably inactive leucine-rich repeat receptor-like protein kinase At5g48380

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48380`	Probably inactive leucine-rich repeat receptor-like protein kinase At5g48380.	No verified direct reference in this release
`At1g27190`	Probable inactive receptor kinase At1g27190.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0718300`	Receptor kinase involved in brassinosteroid (BR) signal transduction.	Loss of function of a rice brassinosteroid insensitive1 homolog prevents internode elongation and bending of the lamina joint.2000 · DOI: 10.1105/tpc.12.9.1591 The role of OsBRI1 and its homologous genes, OsBRL1 and OsBRL3, in rice.2006 · DOI: 10.1104/pp.105.072330 OsBRI1 Activates BR Signaling by Preventing Binding between the TPR and Kinase Domains of OsBSK3 via Phosphorylation.2016 · DOI: 10.1104/pp.15.01668 OsREM4.1 Interacts with OsSERK1 to Coordinate the Interlinking between Abscisic Acid and Brassinosteroid Signaling in Rice.2016 · DOI: 10.1016/j.devcel.2016.06.011

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036691 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009729 detection of brassinosteroid stimulus Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

KEGG gene cross-reference

ath:AT1G27190

ath:AT1G69990

ath:AT3G28450

ath:AT5G48380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.502

Rank 1 · TkA02G501240 · TK1151

Cytoplasm0.401

Rank 2 · TkA02G501240 · TK1151

Nucleus0.274

Rank 3 · TkA02G501240 · TK1151

Mitochondrion0.036

Rank 4 · TkA02G501240 · TK1151

Endoplasmic reticulum0.034

Rank 5 · TkA02G501240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr2-120 aa

PF00069Pkinase3-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G501240	`PF07714`	PK_Tyr_Ser-Thr	2	120	9.3e-22	78.3
TkA02G501240	`PF00069`	Pkinase	3	121	1.7e-14	54.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ASS4`	Arabidopsis thaliana	sp\|Q9ASS4\|Y5838_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At5g48380	71.900%	Swiss-Prot	High
`O04567`	Arabidopsis thaliana	sp\|O04567\|Y1719_ARATH Probable inactive receptor kinase At1g27190	56.300%	Swiss-Prot	High
`Q942F3`	Oryza sativa subsp. japonica	sp\|Q942F3\|BRI1_ORYSJ Brassinosteroid LRR receptor kinase BRI1	54.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card