Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1197 bp · TkA02G500180|TK1151|cDNA
ATGATCGAGAGTCAAATGACGAGGTTGGTTCATATGGAGAATTCGGGATTGGTTAACATGATTGTGGACGATAAGTACGATGATTTAAGCCGGATGTACAACTTGTTCCGGAGGCGGTTGAAAGACCCGGTGGATTTCGTTCAGAGACTACTCGATGAAAAAGATAAACACGATAAAATCATAAACCTCGCGTTCAACAACGATAAAACTCATGATGCTGTTCCGATACCTCCAAGAAAAAGACGTGTTCGAAAAATACT...
1197 bp · TkA02G500180|TK1151|CDS
ATGATCGAGAGTCAAATGACGAGGTTGGTTCATATGGAGAATTCGGGATTGGTTAACATGATTGTGGACGATAAGTACGATGATTTAAGCCGGATGTACAACTTGTTCCGGAGGCGGTTGAAAGACCCGGTGGATTTCGTTCAGAGACTACTCGATGAAAAAGATAAACACGATAAAATCATAAACCTCGCGTTCAACAACGATAAAACTCATGATGCTGTTCCGATACCTCCAAGAAAAAGACGTGTTCGAAAAATACT...
Protein
Download Protein FASTA398 aa · TkA02G500180|TK1151|PROTEIN
MIESQMTRLVHMENSGLVNMIVDDKYDDLSRMYNLFRRRLKDPVDFVQRLLDEKDKHDKIINLAFNNDKTHDAVPIPPRKRRVRKILQTTSRETSFIRKKCIRRRGKKPNPKTKNRMRVPIHFKTRRNVHGHENLTRHNARILRGNGPRINRRAHAGGPRPNNRVMADSINHHVQPPPEILTVCDKFRTYYLGTHNGRRLTWQTNMGSADIKATFARGQKNELNVSTYQMCVLMLFNTADRLSYKEIEQAVEIPATELKR...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G500180 |
|---|---|
| TK1151 ID | TkA02G500180 |
| OH-1004 ID | LXL04_013359 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 63.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 64.802Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G500180 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:128169984-128171413 (-) | |||||||||
| Description | Similar to CUL3A: Cullin-3A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0000209 protein polyubiquitination Biological Process GO:0000278 mitotic cell cycle Biological Process GO:0000902 cell morphogenesis Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006366 transcription by RNA polymerase II Biological Process GO:0006368 transcription elongation by RNA polymerase II Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0006513 protein monoubiquitination Biological Process GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0006950 response to stress Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G26830 ath:AT1G69670 ddi:DDB_G0284903 mmu:26554 rno:301555 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00888Cullin1-38 aaPF10537WAC_Acf1_DNA_bd3-33 aaPF26019HTH_TIMELESS27-56 aaPF00888Cullin41-70 aaPF26557Cullin_AB172-295 aaPF03965Penicillinase_R195-249 aaPF01978TrmB238-266 aaPF10557Cullin_Nedd8247-265 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G500180 | PF00888 | Cullin | 1 | 38 | 2.1e-06 | 28.1 |
| TkA02G500180 | PF10537 | WAC_Acf1_DNA_bd | 3 | 33 | 0.26 | 12.4 |
| TkA02G500180 | PF26019 | HTH_TIMELESS | 27 | 56 | 0.24 | 12.4 |
| TkA02G500180 | PF00888 | Cullin | 41 | 70 | 2.1e-06 | 28.1 |
| TkA02G500180 | PF26557 | Cullin_AB | 172 | 295 | 4.7e-45 | 153.7 |
| TkA02G500180 | PF03965 | Penicillinase_R | 195 | 249 | 0.082 | 14.0 |
| TkA02G500180 | PF01978 | TrmB | 238 | 266 | 0.15 | 12.6 |
| TkA02G500180 | PF10557 | Cullin_Nedd8 | 247 | 265 | 1.6e-24 | 86.4 |
| TkA02G500180 | PF10537 | WAC_Acf1_DNA_bd | 311 | 368 | 0.26 | 12.4 |
| TkA02G500180 | PF10557 | Cullin_Nedd8 | 327 | 390 | 1.6e-24 | 86.4 |
| TkA02G500180 | PF26019 | HTH_TIMELESS | 350 | 362 | 0.24 | 12.4 |
| TkA02G500180 | PF03965 | Penicillinase_R | 352 | 396 | 0.082 | 14.0 |
| TkA02G500180 | PF01978 | TrmB | 373 | 396 | 0.15 | 12.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.