TkA02G499840 | RubberDandelionOmics

Gene overview

TkA02G499840

Reference: TK1151 Chr: Chr02 Coordinates: 128080211-128080915 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

492 bp · TkA02G499840|TK1151|cDNA

ATGGTCTCATATGGAAGATGCCTCAAGAATCATGCTGCCAGCAATGGCGGCCATGTTCTGGATGGATGTGGGGATTATATGCCATCATCCATCCCCACATCCCTAGAATGTGATGTGTGTGGCTGCCATCGCAAACTTCCACCACAAAGCTTACCACCAACGGAACAGACTAACAACAAGCACCCGATGATCCTCACCCCTGCAGTGGCTACCGGATCAAACCTAAAGGGGAAAAAACGATTCAGAACAAAATTCTCGGA...

CDS

Download CDS FASTA

492 bp · TkA02G499840|TK1151|CDS

ATGGTCTCATATGGAAGATGCCTCAAGAATCATGCTGCCAGCAATGGCGGCCATGTTCTGGATGGATGTGGGGATTATATGCCATCATCCATCCCCACATCCCTAGAATGTGATGTGTGTGGCTGCCATCGCAAACTTCCACCACAAAGCTTACCACCAACGGAACAGACTAACAACAAGCACCCGATGATCCTCACCCCTGCAGTGGCTACCGGATCAAACCTAAAGGGGAAAAAACGATTCAGAACAAAATTCTCGGA...

Protein

Download Protein FASTA

163 aa · TkA02G499840|TK1151|PROTEIN

MVSYGRCLKNHAASNGGHVLDGCGDYMPSSIPTSLECDVCGCHRKLPPQSLPPTEQTNNKHPMILTPAVATGSNLKGKKRFRTKFSEYQKEKMQEFAERIGWKMLKIEEEMIVGFCKQIGVTKNVFKVWMHNHKSSSNPGNKRNNHQDHTTNVIGVNGSSSSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G499840`
TK1151 ID	TkA02G499840
OH-1004 ID	LXL04_013364
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	68.100
Protein coverage (%)	TK1151 100.000 / OH-1004 84.532 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G499840

Location Chr02:128080211-128080915 (+)

Description Similar to ZHD8: Zinc-finger homeodomain protein 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18350`	Putative transcription factor.	No verified direct reference in this release
`At3g50890`	Putative transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AX53`	Putative transcription factor.	No verified direct reference in this release
`Os05g0579300`	Putative transcription factor.	No verified direct reference in this release
`Os09g0414600`	Putative transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013364 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G69600

ath:AT2G02540

ath:AT3G28920

ath:AT5G15210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.972

Rank 1 · TkA02G499840 · TK1151

Cytoplasm0.088

Rank 2 · TkA02G499840 · TK1151

Cell membrane0.022

Rank 3 · TkA02G499840 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA02G499840 · TK1151

Mitochondrion0.009

Rank 5 · TkA02G499840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04770ZF-HD_dimer2-45 aa

PF05211NLBH55-110 aa

PF00046Homeodomain79-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G499840	`PF04770`	ZF-HD_dimer	2	45	1.3e-17	64.5
TkA02G499840	`PF05211`	NLBH	55	110	0.03	14.6
TkA02G499840	`PF00046`	Homeodomain	79	134	0.03	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPW7`	Arabidopsis thaliana	sp\|Q9ZPW7\|ZHD6_ARATH Zinc-finger homeodomain protein 6	38.600%	Swiss-Prot	Medium
`Q9SVL0`	Arabidopsis thaliana	sp\|Q9SVL0\|ZHD7_ARATH Zinc-finger homeodomain protein 7	34.600%	Swiss-Prot	Medium
`B8AX53`	Oryza sativa subsp. indica	sp\|B8AX53\|ZHD6_ORYSI Zinc-finger homeodomain protein 6	34.200%	Swiss-Prot	Medium
`Q688U3`	Oryza sativa subsp. japonica	sp\|Q688U3\|ZHD6_ORYSJ Zinc-finger homeodomain protein 6	34.600%	Swiss-Prot	Medium
`Q6ER21`	Oryza sativa subsp. japonica	sp\|Q6ER21\|ZHD9_ORYSJ Zinc-finger homeodomain protein 9	31.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card