TkA02G499630 | RubberDandelionOmics

Gene overview

TkA02G499630

Reference: TK1151 Chr: Chr02 Coordinates: 128036836-128037796 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

778 bp · TkA02G499630|TK1151|cDNA

CGGCATTCAGGCTAGCAAAACGAATCTCTGTCAATTCATCTATAAATAGCTGCAGCAGACCTCATTCTTCTTCCATCAAATCATCTTCCCATTTCATCTCCCCCAACTGCAATGGCTAAGTTTTTCGCTGTTTTCCTCCTGGTTTTGATCGCCATCTCCATGCTTCAAGCTACTGTTTCTGCAAATGGAGGACATCGAGGCGGATTCGGACCTGGAAGTTTGACAAGCTCTCAGTGCCCTGGCCAATGCATAAGGAGATG...

CDS

Download CDS FASTA

303 bp · TkA02G499630|TK1151|CDS

ATGGCTAAGTTTTTCGCTGTTTTCCTCCTGGTTTTGATCGCCATCTCCATGCTTCAAGCTACTGTTTCTGCAAATGGAGGACATCGAGGCGGATTCGGACCTGGAAGTTTGACAAGCTCTCAGTGCCCTGGCCAATGCATAAGGAGATGCAGCAAAACGCAGTACCACAAGCCATGCATGTTCTTCTGCCAAAAGTGCTGTGCGAAATGCCTCTGTGTACCTCCAGGTTTCTATGGTAACAAGCAAGTATGTCCATGCTA...

Protein

Download Protein FASTA

100 aa · TkA02G499630|TK1151|PROTEIN

MAKFFAVFLLVLIAISMLQATVSANGGHRGGFGPGSLTSSQCPGQCIRRCSKTQYHKPCMFFCQKCCAKCLCVPPGFYGNKQVCPCYNNWKTKEGGPKCP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G499630`
TK1151 ID	TkA02G499630
OH-1004 ID	LXL04_013366
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 56.180 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G499630

Location Chr02:128036836-128037796 (-)

Description Similar to GASA6: Gibberellin-regulated protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74670`	Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.	No verified direct reference in this release
`At5g15230`	Gibberellin-regulated protein involved in the regulation of floral meristem and floral organ identity, and promotion of seed size and weight.	GASA4, one of the 14-member Arabidopsis GASA family of small polypeptides, regulates flowering and seed development.2007 · DOI: 10.1093/pcp/pcm016 The Arabidopsis cysteine-rich protein GASA4 promotes GA responses and exhibits redox activity in bacteria and in planta.2010 · DOI: 10.1111/j.1365-313x.2010.04390.x
`At3g02885`	Gibberellin-regulated protein that acts as a negative regulator of gibberellin-induced flowering and stem growth.	GASA5, a regulator of flowering time and stem growth in Arabidopsis thaliana.2009 · DOI: 10.1007/s11103-009-9452-7 Overexpression of GASA5 increases the sensitivity of Arabidopsis to heat stress.2011 · DOI: 10.1016/j.jplph.2011.06.010
`At3g10185`	Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013366 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009749 response to glucose Biological Process

GO:0009750 response to fructose Biological Process

GO:0009831 plant-type cell wall modification involved in multidimensional cell growth Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

KEGG gene cross-reference

ath:AT1G74670

ath:AT2G30810

ath:AT5G15230

sly:101248254

sly:543963

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.895

Rank 1 · TkA02G499630 · TK1151

Cytoplasm0.042

Rank 2 · TkA02G499630 · TK1151

Endoplasmic reticulum0.029

Rank 3 · TkA02G499630 · TK1151

Lysosome / Vacuole0.018

Rank 4 · TkA02G499630 · TK1151

Cell membrane0.017

Rank 5 · TkA02G499630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10917Fungus-induced4-33 aa

PF02704GASA41-100 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G499630	`PF10917`	Fungus-induced	4	33	0.5	11.4
TkA02G499630	`PF02704`	GASA	41	100	2.4e-23	82.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NMQ7`	Arabidopsis thaliana	sp\|Q6NMQ7\|GASA6_ARATH Gibberellin-regulated protein 6	68.300%	Swiss-Prot	High
`P46690`	Arabidopsis thaliana	sp\|P46690\|GASA4_ARATH Gibberellin-regulated protein 4	64.200%	Swiss-Prot	High
`Q84J95`	Arabidopsis thaliana	sp\|Q84J95\|GASA5_ARATH Gibberellin-regulated protein 5	58.100%	Swiss-Prot	High
`A8MR46`	Arabidopsis thaliana	sp\|A8MR46\|GASAD_ARATH Gibberellin-regulated protein 13	78.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card