TkA02G498880 | RubberDandelionOmics

Gene overview

TkA02G498880

Reference: TK1151 Chr: Chr02 Coordinates: 127806288-127808235 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1616 bp · TkA02G498880|TK1151|cDNA

GGTCATTAGTAGAAAGTAGATTAAGAAACGTAGTCAATTTAATTGTAAAATAAGAAATCTACTGCATTCTGACTATAAAAGGCTGGGTCACACGATCTGAATCTGAGCCCAGAAAGATCGAAAACACAAAAATCAGTTACCACCAATCATGTCGTACTACCCGAAAGGTCAGCACTACGAATCCGGCGACGAAGTCGATGACTTCGATGACTATGATTCAACCCCGTATGGAGGAGGCTACGACATTCACCTGACCTATG...

CDS

Download CDS FASTA

1128 bp · TkA02G498880|TK1151|CDS

ATGTCGTACTACCCGAAAGGTCAGCACTACGAATCCGGCGACGAAGTCGATGACTTCGATGACTATGATTCAACCCCGTATGGAGGAGGCTACGACATTCACCTGACCTATGGCCGTCCTCTCCCTCCTTCGGAGGAAATTTGCTACGCTCCGACCTCAACGTCATCCGGCGGCTTCGACTATGAACGATCTAACTACTCCTCCTACGCCGAGCCAAGTGCCTACGGCGAAGAAGCCCTTGACAATGAATACAAGAACTA...

Protein

Download Protein FASTA

375 aa · TkA02G498880|TK1151|PROTEIN

MSYYPKGQHYESGDEVDDFDDYDSTPYGGGYDIHLTYGRPLPPSEEICYAPTSTSSGGFDYERSNYSSYAEPSAYGEEALDNEYKNYVRRKPRPGHQPTGVTTQHGGGYGGASAYGRPEEPTSEYGSGYGRRPEEPTSEYGSGYGRKQEEPTSEYGSGYGRKQEEPTSEYGSGYGRNQEEPTSEYGSGYGRKHEERQEEPTSEYGSGYGRKHEEPTSEYGSGYGRRQEEPTSEYGSGYGRQQEEPTSEYGSGYGRRKEEP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G498880`
TK1151 ID	TkA02G498880
OH-1004 ID	LXL04_013384
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 35.200 / OH-1004 16.709 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G498880

Location Chr02:127806288-127808235 (+)

Description Similar to At5g39570: Uncharacterized protein At5g39570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39570`	Uncharacterized protein At5g39570.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013384 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007218 neuropeptide signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0005184 neuropeptide hormone activity Molecular Function

GO:0070300 phosphatidic acid binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.540

Rank 1 · TkA02G498880 · TK1151

Nucleus0.371

Rank 2 · TkA02G498880 · TK1151

Extracellular0.315

Rank 3 · TkA02G498880 · TK1151

Cell membrane0.074

Rank 4 · TkA02G498880 · TK1151

Endoplasmic reticulum0.044

Rank 5 · TkA02G498880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29337GRP0101-191 aa

PF29337GRP0104-314 aa

PF13634Nucleoporin_FG110-152 aa

PF13634Nucleoporin_FG121-195 aa

PF13634Nucleoporin_FG165-240 aa

PF13634Nucleoporin_FG215-291 aa

PF04889Cwf_Cwc_15316-364 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G498880	`PF29337`	GRP0	101	191	2.5	8.0
TkA02G498880	`PF29337`	GRP0	104	314	2.5	8.0
TkA02G498880	`PF13634`	Nucleoporin_FG	110	152	0.029	16.0
TkA02G498880	`PF13634`	Nucleoporin_FG	121	195	0.029	16.0
TkA02G498880	`PF13634`	Nucleoporin_FG	165	240	0.029	16.0
TkA02G498880	`PF13634`	Nucleoporin_FG	215	291	0.029	16.0
TkA02G498880	`PF04889`	Cwf_Cwc_15	316	364	0.13	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKA5`	Arabidopsis thaliana	sp\|Q9FKA5\|Y5957_ARATH Uncharacterized protein At5g39570	49.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card