TkA02G497400 | RubberDandelionOmics

Gene overview

TkA02G497400

Reference: TK1151 Chr: Chr02 Coordinates: 127353090-127356132 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1449 bp · TkA02G497400|TK1151|cDNA

TCTCAGGTTTTCTTAAAACTTCTTCCCGTCACCACCTACCTGAGCAAAACCCTTGTAAAACCCATCCTTTCTAGTTTTCACCATGGTGCGCACCTGTAAACGATCCCGATCGGAATCCTACCGGCGTATCTTCATCTAAATCGTCCGCCTCCTCCCGTTCGTCACCATATTCATCTGAAACTACAACTCTCTGCTCTTTGGTATCTCCGCATCTCCATCTACCACTATCATCGCCGATTCTCGTTCCCTCCTTCTCCGGC...

CDS

Download CDS FASTA

555 bp · TkA02G497400|TK1151|CDS

ATGTCAAGTACACCCATGTTCACTAGAAGTTATAGGGCAGTGAATCCCACAAAGGTACCTAATGGACTTACTGCTAGAGCAGAAGGAACGATGTTCAGTAGAGCAATTTCATGCTCTGATGTTCAAGTTAAAAGAAGCTTTTCATCAAACTCAGGCCTTCCCCCACACCAAGAAATTGGGATGCCTTCACTTTCACCCACAATGACAGAGGGCATCATAGCAAGGTGGTTAAAGAAAGAAGGAGATCAAGTTGCTCCCGG...

Protein

Download Protein FASTA

184 aa · TkA02G497400|TK1151|PROTEIN

MSSTPMFTRSYRAVNPTKVPNGLTARAEGTMFSRAISCSDVQVKRSFSSNSGLPPHQEIGMPSLSPTMTEGIIARWLKKEGDQVAPGEVLCEVETDKATVEMECMEEGFLAKIVHGDGAKEIQVGQVIAITVEDKADIEKFKDYKPDTSSDGGAPEAPPAPTPTLPKEEVVDKPVSCEAVQFRI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G497400`
TK1151 ID	TkA02G497400
OH-1004 ID	LXL04_002167
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.900
Protein coverage (%)	TK1151 95.652 / OH-1004 31.522 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G497400

Location Chr02:127353090-127356132 (-)

Description Similar to At1g54220: Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13930`	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).	No verified direct reference in this release
`At1g54220`	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002167 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006006 glucose metabolic process Biological Process

GO:0006086 pyruvate decarboxylation to acetyl-CoA Biological Process

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0042867 pyruvate catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0045254 pyruvate dehydrogenase complex Cellular Component

GO:0120212 sperm head-tail coupling apparatus Cellular Component

GO:0160157 branched-chain alpha-ketoacid dehydrogenase complex Cellular Component

KEGG gene cross-reference

ath:AT1G54220

ath:AT3G13930

hsa:1737

mmu:235339

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.872

Rank 1 · TkA02G497400 · TK1151

Plastid0.094

Rank 2 · TkA02G497400 · TK1151

Cytoplasm0.063

Rank 3 · TkA02G497400 · TK1151

Nucleus0.034

Rank 4 · TkA02G497400 · TK1151

Cell membrane0.020

Rank 5 · TkA02G497400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00364Biotin_lipoyl18-30 aa

PF00364Biotin_lipoyl58-129 aa

PF25984BSH_YknX67-95 aa

PF02749QRPTase_N68-95 aa

PF25997BSH_YhbJ69-132 aa

PF26018BSH_RND_rel69-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G497400	`PF00364`	Biotin_lipoyl	18	30	1.2e-18	67.4
TkA02G497400	`PF00364`	Biotin_lipoyl	58	129	1.2e-18	67.4
TkA02G497400	`PF25984`	BSH_YknX	67	95	0.24	11.9
TkA02G497400	`PF02749`	QRPTase_N	68	95	0.037	15.0
TkA02G497400	`PF25997`	BSH_YhbJ	69	132	3.5e-06	27.7
TkA02G497400	`PF26018`	BSH_RND_rel	69	133	0.00087	19.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWN9`	Arabidopsis thaliana	sp\|Q8RWN9\|ODP22_ARATH Dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial	74.700%	Swiss-Prot	High
`Q5M729`	Arabidopsis thaliana	sp\|Q5M729\|ODP23_ARATH Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial	70.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card