TkA02G497300 | RubberDandelionOmics

Gene overview

TkA02G497300

Reference: TK1151 Chr: Chr02 Coordinates: 127321864-127322580 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

549 bp · TkA02G497300|TK1151|cDNA

CCACCTGGAGTAATGGGATGGTGGCCCTCACGTGCTGTCACTTTCTTGGAAAACCATGATACTGGGGTCACTGGCCATTCCCACGAGATAAACTCATGCAAGGATATGCGTATATCTTAACCCACCCAGGAACTCCTGTGGTGTTTTATGATCATTTTTATGATTTTGGGATCCATGATGTGATAACGGAGCTGATTGAGGGAAGGAAACGGGCGGGGATCCACTGTAGGAGTGTTGTGAAGATTTATCATGCGAATAGT...

CDS

Download CDS FASTA

312 bp · TkA02G497300|TK1151|CDS

ATGCAAGGATATGCGTATATCTTAACCCACCCAGGAACTCCTGTGGTGTTTTATGATCATTTTTATGATTTTGGGATCCATGATGTGATAACGGAGCTGATTGAGGGAAGGAAACGGGCGGGGATCCACTGTAGGAGTGTTGTGAAGATTTATCATGCGAATAGTGATGGGTATGTGGCGGGGATTGGTGAGACGTTGGTGATGAAACTTGGGCAGTTTGCTTGGAATCCTTCGAAAGAGATTGACCTTGATGGGAGTTG...

Protein

Download Protein FASTA

103 aa · TkA02G497300|TK1151|PROTEIN

MQGYAYILTHPGTPVVFYDHFYDFGIHDVITELIEGRKRAGIHCRSVVKIYHANSDGYVAGIGETLVMKLGQFAWNPSKEIDLDGSWQKFVDKGSDYQIWVER

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G497300`
TK1151 ID	TkA02G497300
OH-1004 ID	LXL04_013419
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.000
Protein coverage (%)	TK1151 98.058 / OH-1004 16.777 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G497300

Location Chr02:127321864-127322580 (+)

Description Similar to AMY3: Alpha-amylase 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76130`	Probable alpha-amylase that does not seem to be required for breakdown of transitory starch in leaves.	alpha-Amylase is not required for breakdown of transitory starch in Arabidopsis leaves.2005 · DOI: 10.1074/jbc.m413638200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013419 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005983 starch catabolic process Biological Process

GO:0005987 sucrose catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004556 alpha-amylase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G69830

ath:AT1G76130

dosa:Os06g0713800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.657

Rank 1 · TkA02G497300 · TK1151

Nucleus0.383

Rank 2 · TkA02G497300 · TK1151

Endoplasmic reticulum0.077

Rank 3 · TkA02G497300 · TK1151

Lysosome / Vacuole0.074

Rank 4 · TkA02G497300 · TK1151

Cell membrane0.050

Rank 5 · TkA02G497300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09081AMT4_dom_C22-72 aa

PF07821Alpha-amyl_C239-100 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G497300	`PF09081`	AMT4_dom_C	22	72	1.6e-06	28.7
TkA02G497300	`PF07821`	Alpha-amyl_C2	39	100	8.3e-17	62.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LFG1`	Arabidopsis thaliana	sp\|Q8LFG1\|AMY2_ARATH Probable alpha-amylase 2	50.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card