TkA02G495020 | RubberDandelionOmics

Gene overview

TkA02G495020

Reference: TK1151 Chr: Chr02 Coordinates: 126746273-126749226 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2300 bp · TkA02G495020|TK1151|cDNA

AAGTGAGGTATTCAGGCAACGCTTTATATCCGCCCCTGGCCCCTGCCTATGTATAACAAACCCTTTTCAAACGCGACGCTATAATATCAACAAGTAGTTTGTTCCCGCAAGTCTCTGCGATCGATCCGTCTGTTGGGTCGTCACCCTATAATCTTATTTGATTCAGGTTTCGAGTTCATTCATGTGCTAGAATTCTAGATCTTTCCTTGTAAAGCGCATATTTAACCATACCTTGGAGCACACGCAACTCTTATTATAGC...

CDS

Download CDS FASTA

906 bp · TkA02G495020|TK1151|CDS

ATGGCGATGGCGAACCTTTTTTTGAAACCCTCGTCGATTATCGTTGCTCCAAATCTCACTGAATCGTCTCCTTCTCGATCGAATCGGCGTGCCTTTTATACTCCACCAACCTCCTCCTTAACCATTCCTCTGTCTCATCGTCCTGCTTCGATGCATGCTGCACATCCCATCTCTGCACTCATTAAGGAACATAAGGGTTTTGGTGGCAACATGAACTTGATTGATTTTTGGGGATCCAATTCATCGTCGTTTTGGGATGA...

Protein

Download Protein FASTA

301 aa · TkA02G495020|TK1151|PROTEIN

MAMANLFLKPSSIIVAPNLTESSPSRSNRRAFYTPPTSSLTIPLSHRPASMHAAHPISALIKEHKGFGGNMNLIDFWGSNSSSFWDDVTQTDEKFLCQWAKEDNTVTETQDEKHTVKREIHRSKRSGSKLTRRIYMVISGVSFLAIIAVFSFVLPKQQSSRCTVVPYTDLLGEIRDGNVIRVQLVENSHLIYYNTKSSLQTSQFDSGPNKSPKLFQPKWQYQTRNPVDNKVHLIGMLRDKDITYGSDPQLLSESMKNLSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G495020`
TK1151 ID	TkA02G495020
OH-1004 ID	LXL04_001665
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	38.000
Protein coverage (%)	TK1151 98.007 / OH-1004 57.023 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G495020`
Location	Chr02:126746273-126749226 (-)
Description	Similar to FTSHI3: Probable inactive ATP-dependent zinc metalloprotease FTSHI 3, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001665` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0030163 protein catabolic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0031969 chloroplast membrane Cellular Component GO:0004176 ATP-dependent peptidase activity Molecular Function GO:0004222 metalloendopeptidase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	ath:AT3G02450 pmo:Pmob_0818 sun:SUN_1953 tma:TM0580 tmi:THEMA_01765 tmm:Tmari_0578 tmw:THMA_0595 ttr:Tter_0172 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.743

Rank 1 · TkA02G495020 · TK1151

Mitochondrion0.142

Rank 2 · TkA02G495020 · TK1151

Nucleus0.091

Rank 3 · TkA02G495020 · TK1151

Cytoplasm0.060

Rank 4 · TkA02G495020 · TK1151

Endoplasmic reticulum0.033

Rank 5 · TkA02G495020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26256DUF8060101-152 aa

PF06480FtsH_ext138-246 aa

PF06480FtsH_ext287-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G495020	`PF26256`	DUF8060	101	152	0.048	14.4
TkA02G495020	`PF06480`	FtsH_ext	138	246	1.7e-05	25.7
TkA02G495020	`PF06480`	FtsH_ext	287	297	1.7e-05	25.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card