TkA02G494400 | RubberDandelionOmics

Gene overview

TkA02G494400

Reference: TK1151 Chr: Chr02 Coordinates: 126543964-126545719 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1308 bp · TkA02G494400|TK1151|cDNA

TAACAATATATCCAAGATTTTCGAACAATTTCAGATCGGTTGTTTTAATAGCCATTTTATTTCGATACTTCATGTCACTTCTGGCAAAAACGTTTCACAATAAATAAATTTAGACGTGTCGATGGTCGGATGGCATACAACCATTTTAAAATGAAAGTCAATTGTGTAAGGTTGTCTTTCTTTCCCGATCTGGTACCAACCAAAGCTTCCATTGATGACAAAGTTTACTAAATTATTCCGTACTGGCGTACTCCATCCAT...

CDS

Download CDS FASTA

699 bp · TkA02G494400|TK1151|CDS

ATGACGGTTCCTCTGGTGAAATTCCCACTGTTCTTATGCGTGCGGGTTCTAGGTATAATCGTGGCTGCTTTGGTTCTTATATGGAATATTCGCTACAGAGGAGGATTGGCTCTCATCTCAGACGACAAAAGTCTCATCTTCAATGTTCATCCTGTTCTGATGGTAATTGGCCTTGTTCTGCTAAACGGAGAAGCCATGCTGGCATACAAAACAGTAACAGGAACAAAAAACTACAAAAAGCTAGTCCATCTCTCCCTCCA...

Protein

Download Protein FASTA

232 aa · TkA02G494400|TK1151|PROTEIN

MTVPLVKFPLFLCVRVLGIIVAALVLIWNIRYRGGLALISDDKSLIFNVHPVLMVIGLVLLNGEAMLAYKTVTGTKNYKKLVHLSLQFMAFLLGIIGLWAAWKFHNDKGIDNFYSLHSWLGLACLLLFTIQWGAGFVTFWYPGGSRNSRASLMPWHVFFGVYIYVLAVAACATGLLEKATFLQTNNIISRYSTEAMMVNVLGVLIVVLGGFVILGVISPPNGKGDVLRGSIE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G494400`
TK1151 ID	TkA02G494400
OH-1004 ID	LXL04_013475
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G494400

Location Chr02:126543964-126545719 (-)

Description Similar to CYB561B: Probable transmembrane ascorbate ferrireductase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g38630`	Two-heme-containing cytochrome.	No verified direct reference in this release
`At4g25570`	Two-heme-containing cytochrome.	Localization of an ascorbate-reducible cytochrome b561 in the plant tonoplast.2004 · DOI: 10.1104/pp.103.032359

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0533500`	Two-heme-containing cytochrome.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013475 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0019852 L-ascorbic acid metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0000293 ferric-chelate reductase activity Molecular Function

GO:0009055 electron transfer activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0019904 protein domain specific binding Molecular Function

KEGG gene cross-reference

ath:AT4G25570

ath:AT5G38630

dosa:Os02g0642300

zma:100273009

zma:100384594

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.306

Rank 1 · TkA02G494400 · TK1151

Lysosome / Vacuole0.299

Rank 2 · TkA02G494400 · TK1151

Cytoplasm0.297

Rank 3 · TkA02G494400 · TK1151

Golgi apparatus0.212

Rank 4 · TkA02G494400 · TK1151

Endoplasmic reticulum0.120

Rank 5 · TkA02G494400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13301DUF407912-174 aa

PF01292Ni_hydr_CYTB16-129 aa

PF03188Cytochrom_B56149-181 aa

PF01794Ferric_reduct49-127 aa

PF01794Ferric_reduct89-174 aa

PF13301DUF4079117-170 aa

PF01292Ni_hydr_CYTB126-212 aa

PF03188Cytochrom_B561202-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G494400	`PF13301`	DUF4079	12	174	3.5	8.5
TkA02G494400	`PF01292`	Ni_hydr_CYTB	16	129	1.4	9.4
TkA02G494400	`PF03188`	Cytochrom_B561	49	181	1e-49	169.0
TkA02G494400	`PF01794`	Ferric_reduct	49	127	3.4	8.5
TkA02G494400	`PF01794`	Ferric_reduct	89	174	3.4	8.5
TkA02G494400	`PF13301`	DUF4079	117	170	3.5	8.5
TkA02G494400	`PF01292`	Ni_hydr_CYTB	126	212	1.4	9.4
TkA02G494400	`PF03188`	Cytochrom_B561	202	207	1e-49	169.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SWS1`	Arabidopsis thaliana	sp\|Q9SWS1\|ACFR2_ARATH Transmembrane ascorbate ferrireductase 2	71.500%	Swiss-Prot	High
`Q8L856`	Arabidopsis thaliana	sp\|Q8L856\|ACFR1_ARATH Transmembrane ascorbate ferrireductase 1	47.000%	Swiss-Prot	Medium
`Q7XMK3`	Oryza sativa subsp. japonica	sp\|Q7XMK3\|ACET2_ORYSJ Probable ascorbate-specific transmembrane electron transporter 2	46.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card