TkA02G492790 | RubberDandelionOmics

Gene overview

TkA02G492790

Reference: TK1151 Chr: Chr02 Coordinates: 125994191-125994691 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

501 bp · TkA02G492790|TK1151|cDNA

ATGGGTGCTTGCAGCTCGAAACACGAAGAGAACCGTAGTCCGGCTAAACGGAATAATTGCACGGAAATAGAAGAACCGACGAAAAAGAATGATCAAGTTGTGGCAAGGAAGAGATGGTCGTTTTTGGCGTTATACACTCGAGGTCCGGCTTTTTATTTGTTTTCTAGGAAGCCGCCGCCGTCTCCGGCGAAAAATGGAAGCCAAAATCCGACGGTGAAGCGGTTCTTCAGGAAGGCGTTTCAGCCGCTGACTCGCGCCCA...

CDS

Download CDS FASTA

501 bp · TkA02G492790|TK1151|CDS

ATGGGTGCTTGCAGCTCGAAACACGAAGAGAACCGTAGTCCGGCTAAACGGAATAATTGCACGGAAATAGAAGAACCGACGAAAAAGAATGATCAAGTTGTGGCAAGGAAGAGATGGTCGTTTTTGGCGTTATACACTCGAGGTCCGGCTTTTTATTTGTTTTCTAGGAAGCCGCCGCCGTCTCCGGCGAAAAATGGAAGCCAAAATCCGACGGTGAAGCGGTTCTTCAGGAAGGCGTTTCAGCCGCTGACTCGCGCCCA...

Protein

Download Protein FASTA

166 aa · TkA02G492790|TK1151|PROTEIN

MGACSSKHEENRSPAKRNNCTEIEEPTKKNDQVVARKRWSFLALYTRGPAFYLFSRKPPPSPAKNGSQNPTVKRFFRKAFQPLTRAQHMKAVLARRHGEGKDGVARLNKSFGFSKHIRHKCEIGEEVGKGHFGHTHRAKFKKGEHKGQQVAVKIIPKSKVWFFTFV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G492790`
TK1151 ID	TkA02G492790
OH-1004 ID	LXL04_013507
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 96.386 / OH-1004 27.826 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G492790

Location Chr02:125994191-125994691 (+)

Description Similar to CRK: CDPK-related protein kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50530`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At2g41140`	May play a role in signal transduction pathways that involve calcium as a second messenger (By similarity).	The calmodulin-binding protein kinase 3 is part of heat-shock signal transduction in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03544.x
`At3g56760`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0366200`	Possesses kinase activity in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013507 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009939 positive regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010286 heat acclimation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function

GO:0004713 protein tyrosine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G41140

ath:AT3G19100

ath:AT3G50530

ath:AT3G56760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.543

Rank 1 · TkA02G492790 · TK1151

Cytoplasm0.269

Rank 2 · TkA02G492790 · TK1151

Nucleus0.265

Rank 3 · TkA02G492790 · TK1151

Endoplasmic reticulum0.065

Rank 4 · TkA02G492790 · TK1151

Mitochondrion0.044

Rank 5 · TkA02G492790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr122-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G492790	`PF07714`	PK_Tyr_Ser-Thr	122	157	0.0019	18.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCS2`	Arabidopsis thaliana	sp\|Q9SCS2\|CAMK5_ARATH CDPK-related kinase 5	52.200%	Swiss-Prot	High
`O80673`	Arabidopsis thaliana	sp\|O80673\|CAMK1_ARATH CDPK-related kinase 1	41.800%	Swiss-Prot	Medium
`Q9LET1`	Arabidopsis thaliana	sp\|Q9LET1\|CAMK7_ARATH CDPK-related kinase 7	43.000%	Swiss-Prot	Medium
`Q10KY3`	Oryza sativa subsp. japonica	sp\|Q10KY3\|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1	45.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card